Germany
Japan
United Kingdom
China
Antibodies
Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Collagen II (COL2A1) mouse monoclonal antibody, clone 2G2/49 (COLL-II), Ascites
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
USD 525.00
5 Days
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Immunogen | Human placental type IV Collagen. |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Active filters
Applications
- WB
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (222)
- JUN (173)
- EGFR (156)
- ERBB2 (153)
- CTNNB1 (149)
- AKT1 (116)
- BRAF (92)
- VWF (91)
- BCL2 (86)
- MAPK1 (68)
- PIK3CG (63)
- PARVA (61)
- MET (60)
- PDGFRA (57)
- MAPK8 (54)
- PXN (48)
- VEGFA (48)
- PIK3R5 (46)
- HRAS (45)
- BIRC3 (43)
- VASP (43)
- KDR (42)
- CCND2 (41)
- PDGFRB (41)
- AKT2 (39)
- ACTB (38)
- SPP1 (37)
- CCND1 (35)
- PTK2 (35)
- LAMB3 (32)
- PARVB (32)
- SHC1 (32)
- MAPK9 (31)
- PIK3CD (29)
- RAF1 (29)
- SRC (29)
- BCAR1 (28)
- IGF1 (27)
- MYL7 (26)
- PRKCA (26)
- IGF1R (25)
- EGF (24)
- FLT4 (24)
- HGF (24)
- RAPGEF1 (24)
- VEGFB (24)
- VEGFD (24)
- MAPK3 (22)
- PAK4 (22)
- FN1 (21)
- CAV1 (20)
- MAPK10 (19)
- FLT1 (18)
- PAK1 (18)
- AKT3 (17)
- BAD (17)
- GSK3B (17)
- ITGB1 (17)
- LAMA4 (17)
- ACTN1 (15)
- PTEN (15)
- ITGB3 (14)
- ROCK2 (14)
- COL6A1 (13)
- VCL (13)
- CAPN2 (12)
- PPP1CA (12)
- PRKCB (12)
- FYN (11)
- PDGFB (11)
- PIK3R1 (11)
- COL5A1 (10)
- GRB2 (10)
- ILK (10)
- VEGFC (10)
- COL3A1 (9)
- ELK1 (9)
- MYL9 (9)
- RHOA (9)
- VAV1 (9)
- ACTN2 (8)
- COL1A1 (8)
- FLNA (8)
- ITGA4 (8)
- ACTG1 (7)
- CAV2 (7)
- CCND3 (7)
- ITGAV (7)
- ITGB4 (7)
- LAMB2 (7)
- PAK2 (7)
- PDGFA (7)
- PDPK1 (7)
- PGF (7)
- PPP1CC (7)
- XIAP (7)
- ZYX (7)
- ACTN4 (6)
- BIRC2 (6)
- COL1A2 (6)
Reactivities
- Human (3124)
- Mouse (2643)
- Rat (2538)
- Dog (528)
- Monkey (511)
- Bovine (36)
- Chicken (34)
- Pig (19)
- Rabbit (18)
- Cow (13)
- Xenopus (12)
- Canine (11)
- Canis (8)
- Drosophila (8)
- Hamster (8)
- Rhesus Monkey (8)
- Primate (5)
- Sheep (5)
- X. tropicalis (5)
- Zebrafish (4)
- Guinea Pig (3)
- Porcine (3)
- C. elegans (2)
- Chimpanzee (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Feline (1)
- Goat (1)
- Horse (1)
- Tobacco hornworm (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (3297)
- Protein Kinase (1523)
- ES Cell Differentiation/IPS (1317)
- Transmembrane (814)
- Secreted Protein (552)
- Transcription Factors (345)
- Stem cell - Pluripotency (239)
- Stem cell relevant signaling - JAK/STAT signaling pathway (220)
- Adult stem cells (208)
- Cancer stem cells (156)
- Phosphatase (40)
- Protease (36)
- Stem cell relevant signaling - DSL/Notch pathway (35)
- Stem cell relevant signaling - Wnt Signaling pathway (35)
- Embryonic stem cells (28)
- Induced pluripotent stem cells (28)