Mouse Monoclonal beta Tubulin Antibody
Applications | IF, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat, Chlamydomonas |
Conjugation | Unconjugated |
Mouse Monoclonal beta Tubulin Antibody
Applications | IF, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat, Chlamydomonas |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against Eg5
Applications | WB |
Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
Conjugation | Unconjugated |
Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SR-BI
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mink, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse Scavenger Receptor-BI (within residues 450-509). |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Mouse Monoclonal SREBP1 Antibody (2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat, Golden Syrian Hamster |
Conjugation | Unconjugated |
Rabbit polyclonal HIF1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Hamster |
Conjugation | Unconjugated |
Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Mouse Monoclonal anti-KDELR1 Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal Calnexin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Antibody against SAT1
Applications | WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
Conjugation | Unconjugated |
Immunogen | Full length human protein Hsp70 |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly |
Conjugation | Unconjugated |
Mouse Monoclonal beta-Actin Antibody (8H10D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat, Primate, Hamster |
Conjugation | Unconjugated |
Rabbit polyclonal p38 Antibody
Applications | WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
Conjugation | Unconjugated |
Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal anti-HSPA5 Antibody
Applications | WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide conjugated to KLH |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
NOS1 (1419-1433) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal ABCA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit Polyclonal SREBP1 Antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Rabbit polyclonal DDIT3 Antibody (C-term A135)
Applications | FC, IF, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This DDIT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the C-terminal region of human DDIT3. |
Rabbit polyclonal Vimentin Antibody (S82)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Mouse monoclonal Hsp70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Mouse Monoclonal Actin Antibody (mAbGEa)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against DRP1
Applications | IHC |
Reactivities | Human, Primate, Mouse, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
Rabbit Polyclonal Antibody against VEGFA
Applications | WB |
Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal anti-CALR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
Conjugation | Unconjugated |
Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal COPE Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This COPE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-300 amino acids from the C-terminal region of human COPE. |
Rabbit polyclonal PCYT1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit polyclonal TSN Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TSN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human TSN. |
Rabbit polyclonal Vimentin Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Mouse Monoclonal beta Actin Antibody
Applications | WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Abcc8 mouse monoclonal antibody, clone N289/16
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Abcc8 mouse monoclonal antibody, clone N289/16
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit Polyclonal anti-CANX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-HSPA5 Antibody
Applications | IF, WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide (amino acids 645-654, C-terminus) conjugated to KLH. Identical to mouse and hamster GRP78 sequenes over residues EEDTSEKDEL. |
Rabbit Polyclonal anti-UBB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
Conjugation | Unconjugated |
Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Mouse Monoclonal OPA1 Antibody (1E8-1D9)
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Chinese Hamster |
Conjugation | Unconjugated |