Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal ZIPK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZIP kinase antibody was raised against a peptide corresponding to amino acids near the center of human ZIP kinase. The immunogen is located within amino acids 270 - 320 of ZIPK. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Pathways in cancer
Filter by
Target Symbol
- TP53 (169)
- ERBB2 (144)
- MAP2K1 (143)
- CDKN2A (126)
- EGFR (122)
- IL6 (122)
- JUN (122)
- CTNNB1 (98)
- AKT1 (95)
- GLI1 (93)
- MDM2 (76)
- NKX3-1 (72)
- BCL2 (67)
- BRAF (67)
- KIT (55)
- MLH1 (55)
- STAT5A (50)
- CDH1 (47)
- MAPK1 (46)
- MTOR (44)
- RELA (44)
- CDK2 (43)
- FOS (43)
- FGFR2 (42)
- MET (42)
- FOXO1 (41)
- BID (40)
- PIK3CG (40)
- RB1 (40)
- KLK3 (38)
- RET (38)
- CASP3 (36)
- PDGFRA (36)
- MYC (35)
- VEGFA (35)
- AR (34)
- KRAS (34)
- STAT1 (34)
- RARA (32)
- BIRC5 (31)
- HDAC1 (31)
- IKBKG (30)
- RASSF1 (30)
- AKT2 (29)
- MAPK8 (29)
- NFKB1 (29)
- PDGFRB (29)
- HRAS (28)
- NFKBIA (28)
- PIK3R5 (28)
- PTGS2 (28)
- WNT3 (28)
- BAX (27)
- BIRC3 (27)
- FGFR1 (27)
- CDKN1A (26)
- STAT3 (26)
- DVL2 (25)
- HSP90AB1 (25)
- ARNT (24)
- FN1 (24)
- LAMB3 (24)
- BCL2L1 (23)
- CDKN2B (23)
- MAP2K2 (23)
- PIK3CD (23)
- SMAD2 (23)
- CCND1 (22)
- HDAC2 (22)
- IGF1R (22)
- PTCH1 (22)
- PTK2 (22)
- HGF (21)
- NOS2 (21)
- RAF1 (21)
- CHUK (20)
- EGF (20)
- FGF2 (20)
- SMAD3 (20)
- CASP9 (19)
- CSF1R (19)
- MAPK9 (19)
- CSF2RA (18)
- DAPK2 (18)
- IGF1 (18)
- IKBKB (18)
- ITGB1 (18)
- KITLG (18)
- MMP2 (18)
- PRKCA (18)
- TGFB1 (18)
- BAD (17)
- GSK3B (17)
- HSP90AA1 (17)
- MAX (17)
- PTEN (17)
- APC (16)
- ARAF (16)
- CXCL8 (16)
- NCOA4 (16)
Reactivities
- Human (5131)
- Mouse (3539)
- Rat (3242)
- Monkey (403)
- Dog (388)
- Bovine (70)
- Pig (53)
- Chicken (49)
- Cow (33)
- Canine (22)
- Primate (20)
- Rabbit (20)
- Xenopus (20)
- Hamster (14)
- Horse (11)
- Zebrafish (10)
- Rhesus Monkey (9)
- Drosophila (8)
- Feline (8)
- Sheep (7)
- Chimpanzee (6)
- Porcine (5)
- Bat (4)
- Gerbil (4)
- Gorilla (4)
- Guinea Pig (4)
- X. tropicalis (4)
- Canis (3)
- C. elegans (2)
- Equine (2)
- Ferret (2)
- Fish (2)
- Frog (2)
- Macaque (2)
- Yeast (2)
- Fungi (1)
- Gibbon (1)
- Insect (1)
- Mammalian (1)
- Opossum (1)
- Orang-Utan (1)
- Plant (1)
- Quail (1)
- Tobacco hornworm (1)