Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
USD 405.00
2 Weeks
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, clone G043, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-cardiac troponin T Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified
| Applications | ELISA, R |
| Reactivities | Human |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
beta Actin (ACTB) mouse monoclonal antibody, clone AC-15, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
beta Actin (ACTB) mouse monoclonal antibody, clone 26F7, Aff - Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
USD 290.00
In Stock
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone n.a, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
USD 290.00
In Stock
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone n.a, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit anti-ITGA2B Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGA2B |
Mouse Monoclonal beta Actin Antibody
| Applications | WB |
| Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-Integrin aV Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV |
Rabbit Polyclonal Anti-Integrin a3 (CD49c) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a3 (CD49c) Antibody: A synthesized peptide |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- ES Cell Differentiation/IPS
Pathways
- Dilated cardiomyopathy
Filter by
Target Symbol
Reactivities
- Human (214)
- Mouse (169)
- Rat (154)
- Dog (17)
- Monkey (14)
- Chicken (6)
- Rabbit (6)
- Drosophila (4)
- Bovine (3)
- Hamster (3)
- Canine (2)
- Cow (2)
- Pig (2)
- Rhesus Monkey (2)
- Zebrafish (2)
- All Species (1)
- Avian (1)
- Baboon (1)
- Bat (1)
- Broad (1)
- Chimpanzee (1)
- Feline (1)
- Goat (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Primate (1)
- Sheep (1)