Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal antibody to BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 667 and 951 of BMPR2 (Uniprot ID#Q13873) |
Rabbit anti-BMPR1A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMPR1A |
Rabbit Polyclonal Anti-BMPR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMPR2 Antibody: A synthesized peptide derived from human BMPR2 |
Rabbit polyclonal TGF Beta Receptor I (Ab-165) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGF β Receptor I around the phosphorylation site of serine 165 (D-P-SP-L-D). |
Rabbit polyclonal anti-TGF beta2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit polyclonal anti-ACVR1C (ALK7) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 155 of mouse ALK-7 |
Rabbit anti-ACVR1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACVR1B |
Rabbit anti-BMPR2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMPR2 |
Goat Polyclonal Anti-AMHR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMHR2 Antibody: Peptide with sequence HPQESHPFPESCPR, from the internal region of the protein sequence according to NP_065434.1; NP_001158163.1. |
Goat Polyclonal Anti-AMHR2 (aa88-99) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMHR2 (aa88-99) Antibody: Peptide with sequence ESLHCDPSPRAH, from the internal region of the protein sequence according to NP_065434.1; NP_001158162.1; NP_001158163.1. |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Activin Receptor Type IIA (ACVR2A) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 30-80 of Human ACTR-IIA. |
Activin Receptor Type IA (ACVR1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | ACVR1 antibody was raised against aCVR1C antibody was raised against a 15 amino acid peptide near the amino terminus of the human ACVR1C. |
Goat Polyclonal Antibody against BMPR1A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KSDSDQKKSEN, from the internal region of the protein sequence according to NP_004320.2. |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-ACVR1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP |
Rabbit anti TGF beta R1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal epitope (180aa-210aa) of human TGFbR1 protein |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
ACVRL1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-KISNSPEKPKVIQ, from the C Terminus of the protein sequence according to NP_000011.2; NP_001070869.1. |
Active filters
Category
- Antibodies
Families
- Transmembrane
Pathways
- TGF-beta signaling pathway