Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
USD 380.00
2 Weeks
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- GAPDH (7)
- CANX (5)
- HIF1A (4)
- BAX (3)
- PECAM1 (3)
- PPARGC1A (3)
- ABCC4 (2)
- ABCG2 (2)
- ADH5 (2)
- AOX1 (2)
- BAG3 (2)
- BRAF (2)
- CALCRL (2)
- CASP9 (2)
- CCNA2 (2)
- CCR6 (2)
- CD63 (2)
- CDH2 (2)
- CHMP4C (2)
- COL1A1 (2)
- CTNNB1 (2)
- CTSD (2)
- DDX58 (2)
- ELOVL5 (2)
- GAD1 (2)
- GJA1 (2)
- H3C1 (2)
- HMOX1 (2)
- IL18 (2)
- IPMK (2)
- IRS1 (2)
- KDR (2)
- MAP1LC3B (2)
- MAP3K5 (2)
- MAPK8 (2)
- MTNR1A (2)
- NOS3 (2)
- PFKFB2 (2)
- RAB27A (2)
- RAC1 (2)
- RELA (2)
- SERPINA3 (2)
- SLC2A1 (2)
- SLC44A1 (2)
- SPRY1 (2)
- STAT5A (2)
- TSG101 (2)
- VCL (2)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC5 (1)
- ABCC8 (1)
- ABCD2 (1)
- ABCD3 (1)
- ACER1 (1)
- ACSL3 (1)
- ACSL4 (1)
- ACTA2 (1)
- ACTB (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGPAT2 (1)
- AHCY (1)
- AHSP (1)
- AICDA (1)
- AIM2 (1)
- AIMP1 (1)
- AKAP12 (1)
- AKR1B10 (1)
- AKT1 (1)
- ALPG (1)
- ANAPC10 (1)
- ANGPTL8 (1)
- ANTXR1 (1)
- AP1M1 (1)
- APAF1 (1)
- APOBEC3B (1)
- AQP4 (1)
- ARAP1 (1)
- ARSA (1)
- ARSB (1)
- ASAH1 (1)
- ATG12 (1)
- ATG5 (1)
- ATP6V1H (1)
- ATRX (1)
- ATXN1 (1)
- AURKB (1)
- AUTS2 (1)
- AZGP1 (1)
- B3GLCT (1)
- BAK1 (1)
- BARD1 (1)
Applications
Antibody Hosts
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (404)
- Transmembrane (197)
- Transcription Factors (80)
- ES Cell Differentiation/IPS (61)
- Secreted Protein (56)
- Protein Kinase (43)
- GPCR (21)
- Protease (20)
- Stem cell - Pluripotency (17)
- Adult stem cells (12)
- Embryonic stem cells (8)
- Cancer stem cells (7)
- Nuclear Hormone Receptor (7)
- Ion Channels: Other (6)
- Stem cell relevant signaling - JAK/STAT signaling pathway (6)
- Induced pluripotent stem cells (5)
- P450 (5)
- Stem cell relevant signaling - DSL/Notch pathway (4)
- Ion Channels: Glutamate Receptors (3)
- Ion Channels: Transient receptor potential (3)
- Phosphatase (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Ion Channels: Cys-loop Receptors (2)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Calcium (1)
Pathways
- Pathways in cancer (78)
- Metabolic pathways (61)
- Focal adhesion (46)
- MAPK signaling pathway (36)
- Regulation of actin cytoskeleton (30)
- Pancreatic cancer (28)
- Alzheimer's disease (27)
- Colorectal cancer (27)
- Chemokine signaling pathway (26)
- Neurotrophin signaling pathway (25)
- Small cell lung cancer (23)
- Huntington's disease (22)
- Leukocyte transendothelial migration (22)
- Prostate cancer (22)
- Toll-like receptor signaling pathway (22)
- Adipocytokine signaling pathway (21)
- Renal cell carcinoma (21)
- Chronic myeloid leukemia (20)
- Cytokine-cytokine receptor interaction (20)
- Insulin signaling pathway (20)
- Apoptosis (19)
- ErbB signaling pathway (19)
- Neuroactive ligand-receptor interaction (19)
- Adherens junction (18)
- Endocytosis (18)
- RIG-I-like receptor signaling pathway (18)
- p53 signaling pathway (18)
- Amyotrophic lateral sclerosis (ALS) (17)
- ECM-receptor interaction (17)
- Jak-STAT signaling pathway (17)
- Natural killer cell mediated cytotoxicity (17)
- Wnt signaling pathway (17)
- Cell adhesion molecules (CAMs) (16)
- VEGF signaling pathway (16)
- Acute myeloid leukemia (15)
- Calcium signaling pathway (15)
- Progesterone-mediated oocyte maturation (15)
- Vascular smooth muscle contraction (15)
- Epithelial cell signaling in Helicobacter pylori infection (14)
- Glycolysis / Gluconeogenesis (14)
- Lysosome (14)
- Melanoma (14)
- NOD-like receptor signaling pathway (14)
- T cell receptor signaling pathway (14)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (13)
- Axon guidance (13)
- B cell receptor signaling pathway (13)
- Bladder cancer (13)
- Cell cycle (13)
- Endometrial cancer (13)
- Fc epsilon RI signaling pathway (13)
- Gap junction (13)
- Glioma (13)
- Non-small cell lung cancer (13)
- Viral myocarditis (12)
- mTOR signaling pathway (12)
- ABC transporters (11)
- Antigen processing and presentation (11)
- Cytosolic DNA-sensing pathway (11)
- Fc gamma R-mediated phagocytosis (11)
- GnRH signaling pathway (11)
- Hematopoietic cell lineage (11)
- Tight junction (11)
- Type II diabetes mellitus (11)
- Dilated cardiomyopathy (10)
- Parkinson's disease (10)
- Hypertrophic cardiomyopathy (HCM) (9)
- Pathogenic Escherichia coli infection (9)
- TGF-beta signaling pathway (9)
- Complement and coagulation cascades (8)
- Long-term depression (8)
- Melanogenesis (8)
- Long-term potentiation (7)
- PPAR signaling pathway (7)
- Prion diseases (7)
- Thyroid cancer (7)
- Type I diabetes mellitus (7)
- Drug metabolism - cytochrome P450 (6)
- Oocyte meiosis (6)
- Oxidative phosphorylation (6)
- Porphyrin and chlorophyll metabolism (6)
- Basal cell carcinoma (5)
- Fatty acid metabolism (5)
- Fructose and mannose metabolism (5)
- Metabolism of xenobiotics by cytochrome P450 (5)
- Sphingolipid metabolism (5)
- Systemic lupus erythematosus (5)
- Tyrosine metabolism (5)
- Ubiquitin mediated proteolysis (5)
- Allograft rejection (4)
- Androgen and estrogen metabolism (4)
- Arginine and proline metabolism (4)
- Butanoate metabolism (4)
- Cardiac muscle contraction (4)
- Citrate cycle (TCA cycle) (4)
- Dorso-ventral axis formation (4)
- Regulation of autophagy (4)
- Retinol metabolism (4)
- Spliceosome (4)
- Alanine (3)
- Autoimmune thyroid disease (3)
- Galactose metabolism (3)
- Glycerophospholipid metabolism (3)
- Graft-versus-host disease (3)
- Homologous recombination (3)
- Linoleic acid metabolism (3)
- Purine metabolism (3)
- SNARE interactions in vesicular transport (3)
- Starch and sucrose metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Tryptophan metabolism (3)
- Valine (3)
- Vibrio cholerae infection (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Biosynthesis of unsaturated fatty acids (2)
- Cysteine and methionine metabolism (2)
- DNA replication (2)
- Drug metabolism - other enzymes (2)
- Ether lipid metabolism (2)
- Folate biosynthesis (2)
- Glycosaminoglycan degradation (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Inositol phosphate metabolism (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- N-Glycan biosynthesis (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Olfactory transduction (2)
- Pentose phosphate pathway (2)
- Primary bile acid biosynthesis (2)
- Primary immunodeficiency (2)
- RNA degradation (2)
- Renin-angiotensin system (2)
- Vitamin B6 metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Asthma (1)
- Base excision repair (1)
- C21-Steroid hormone metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Circadian rhythm - mammal (1)
- Glycerolipid metabolism (1)
- Hedgehog signaling pathway (1)
- Heparan sulfate biosynthesis (1)
- Nucleotide excision repair (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Pentose and glucuronate interconversions (1)
- Phosphatidylinositol signaling system (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Ribosome (1)
- Selenoamino acid metabolism (1)
- alpha-Linolenic acid metabolism (1)