Germany
Japan
United Kingdom
China
Antibodies
Download
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 479.00
2 Weeks
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 380.00
2 Weeks
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Families
- Druggable Genome
Citations
- Yes
Filter by
Target Symbol
- MKI67 (9)
- TP53 (9)
- CD274 (8)
- CD4 (8)
- LGR5 (8)
- CD19 (7)
- CDH2 (7)
- PECAM1 (7)
- VEGFA (7)
- CANX (6)
- GBE1 (6)
- MAPK8 (6)
- MME (6)
- SNAI1 (6)
- ALK (5)
- BAX (5)
- BECN1 (5)
- CD34 (5)
- CHGA (5)
- CTNNB1 (5)
- KRT8 (5)
- MMP2 (5)
- NCAM1 (5)
- ADIPOQ (4)
- ALDH1A3 (4)
- ARNTL (4)
- CCN2 (4)
- CD163 (4)
- CD44 (4)
- CD8A (4)
- CDX2 (4)
- DPP9 (4)
- ERBB2 (4)
- LOXL2 (4)
- LTA4H (4)
- MAPK1 (4)
- MCL1 (4)
- MS4A1 (4)
- NEU1 (4)
- NR4A3 (4)
- PARP1 (4)
- PDE10A (4)
- POSTN (4)
- RELA (4)
- SLC7A8 (4)
- SNAI2 (4)
- SPP1 (4)
- SQSTM1 (4)
- TP63 (4)
- UNG (4)
- ABCG2 (3)
- AKT1 (3)
- ALDH1L1 (3)
- ALDH2 (3)
- APOE (3)
- BCL2 (3)
- BIRC3 (3)
- BIRC5 (3)
- CD3E (3)
- CD63 (3)
- CD68 (3)
- CDH1 (3)
- CDH3 (3)
- CDKN2A (3)
- EPAS1 (3)
- ERCC1 (3)
- FGF2 (3)
- GBA (3)
- HK2 (3)
- HNRNPM (3)
- HSP90AA1 (3)
- HSPD1 (3)
- IDO1 (3)
- IGF1R (3)
- IL1B (3)
- JAK2 (3)
- LAMB3 (3)
- LIMK1 (3)
- MAPK3 (3)
- MGMT (3)
- MSR1 (3)
- MX1 (3)
- MYD88 (3)
- NOTCH1 (3)
- NTRK2 (3)
- PDCD1 (3)
- PPARGC1A (3)
- PPP4C (3)
- PRKAR1A (3)
- RAC1 (3)
- SDCBP (3)
- SOD1 (3)
- STAT3 (3)
- TGFBR2 (3)
- TNNI3 (3)
- TUBB (3)
- TUBB4A (3)
- ZEB2 (3)
- ABCC4 (2)
- ABCD1 (2)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (191)
- Metabolic pathways (119)
- Focal adhesion (102)
- MAPK signaling pathway (92)
- Pancreatic cancer (79)
- Colorectal cancer (76)
- Cell adhesion molecules (CAMs) (74)
- Prostate cancer (73)
- Neurotrophin signaling pathway (72)
- Hematopoietic cell lineage (64)
- Apoptosis (60)
- Small cell lung cancer (60)
- Chronic myeloid leukemia (59)
- Toll-like receptor signaling pathway (59)
- Bladder cancer (56)
- Regulation of actin cytoskeleton (56)
- T cell receptor signaling pathway (56)
- Adherens junction (54)
- Melanoma (54)
- Chemokine signaling pathway (53)
- Progesterone-mediated oocyte maturation (52)
- Renal cell carcinoma (52)
- Endometrial cancer (50)
- Glioma (48)
- Insulin signaling pathway (48)
- Adipocytokine signaling pathway (46)
- ErbB signaling pathway (46)
- Amyotrophic lateral sclerosis (ALS) (44)
- Cytokine-cytokine receptor interaction (44)
- Non-small cell lung cancer (44)
- Alzheimer's disease (43)
- p53 signaling pathway (43)
- B cell receptor signaling pathway (42)
- NOD-like receptor signaling pathway (42)
- VEGF signaling pathway (42)
- Leukocyte transendothelial migration (41)
- Huntington's disease (40)
- Wnt signaling pathway (38)
- Natural killer cell mediated cytotoxicity (37)
- Acute myeloid leukemia (36)
- Fc epsilon RI signaling pathway (36)
- Thyroid cancer (36)
- Cell cycle (35)
- Jak-STAT signaling pathway (34)
- Primary immunodeficiency (33)
- Type II diabetes mellitus (33)
- Axon guidance (31)
- Endocytosis (31)
- Gap junction (31)
- Prion diseases (31)
- ECM-receptor interaction (30)
- GnRH signaling pathway (29)
- Fc gamma R-mediated phagocytosis (28)
- Antigen processing and presentation (26)
- Epithelial cell signaling in Helicobacter pylori infection (26)
- Pathogenic Escherichia coli infection (26)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (25)
- Lysosome (25)
- TGF-beta signaling pathway (25)
- mTOR signaling pathway (25)
- Neuroactive ligand-receptor interaction (24)
- Viral myocarditis (24)
- Glycolysis / Gluconeogenesis (23)
- RIG-I-like receptor signaling pathway (23)
- Basal cell carcinoma (22)
- Drug metabolism - cytochrome P450 (22)
- Purine metabolism (21)
- Tight junction (21)
- Long-term depression (20)
- Melanogenesis (20)
- Oocyte meiosis (20)
- Vascular smooth muscle contraction (20)
- Calcium signaling pathway (19)
- Metabolism of xenobiotics by cytochrome P450 (19)
- Hypertrophic cardiomyopathy (HCM) (18)
- Arachidonic acid metabolism (17)
- Dilated cardiomyopathy (17)
- Dorso-ventral axis formation (17)
- Long-term potentiation (17)
- ABC transporters (16)
- Type I diabetes mellitus (16)
- Cytosolic DNA-sensing pathway (15)
- Complement and coagulation cascades (14)
- Base excision repair (13)
- PPAR signaling pathway (13)
- Retinol metabolism (13)
- Starch and sucrose metabolism (13)
- Tyrosine metabolism (13)
- Ubiquitin mediated proteolysis (13)
- Parkinson's disease (12)
- Graft-versus-host disease (11)
- Tryptophan metabolism (11)
- Fructose and mannose metabolism (10)
- Allograft rejection (9)
- Fatty acid metabolism (9)
- Histidine metabolism (9)
- Linoleic acid metabolism (9)
- Pyrimidine metabolism (9)
- Renin-angiotensin system (9)
- Sphingolipid metabolism (9)
- Arginine and proline metabolism (8)
- Autoimmune thyroid disease (8)
- Systemic lupus erythematosus (8)
- Valine (8)
- leucine and isoleucine degradation (8)
- Butanoate metabolism (7)
- Galactose metabolism (7)
- Nucleotide excision repair (7)
- Other glycan degradation (7)
- Regulation of autophagy (7)
- Alanine (6)
- Cardiac muscle contraction (6)
- Cysteine and methionine metabolism (6)
- Hedgehog signaling pathway (6)
- Phenylalanine metabolism (6)
- Phosphatidylinositol signaling system (6)
- Propanoate metabolism (6)
- Pyruvate metabolism (6)
- aspartate and glutamate metabolism (6)
- beta-Alanine metabolism (6)
- Circadian rhythm - mammal (5)
- Citrate cycle (TCA cycle) (5)
- Inositol phosphate metabolism (5)
- Notch signaling pathway (5)
- One carbon pool by folate (5)
- Porphyrin and chlorophyll metabolism (5)
- Proteasome (5)
- Vibrio cholerae infection (5)
- Androgen and estrogen metabolism (4)
- Ascorbate and aldarate metabolism (4)
- Asthma (4)
- Drug metabolism - other enzymes (4)
- Methane metabolism (4)
- Mismatch repair (4)
- Oxidative phosphorylation (4)
- Pantothenate and CoA biosynthesis (4)
- Primary bile acid biosynthesis (4)
- Spliceosome (4)
- Amino sugar and nucleotide sugar metabolism (3)
- C21-Steroid hormone metabolism (3)
- DNA replication (3)
- Glycerolipid metabolism (3)
- Homologous recombination (3)
- Limonene and pinene degradation (3)
- Lysine degradation (3)
- Maturity onset diabetes of the young (3)
- Pentose phosphate pathway (3)
- RNA degradation (3)
- Taurine and hypotaurine metabolism (3)
- Caffeine metabolism (2)
- Fatty acid elongation in mitochondria (2)
- Folate biosynthesis (2)
- Glycerophospholipid metabolism (2)
- Glycosaminoglycan degradation (2)
- Nicotinate and nicotinamide metabolism (2)
- Nitrogen metabolism (2)
- SNARE interactions in vesicular transport (2)
- Vitamin B6 metabolism (2)
- leucine and isoleucine biosynthesis (2)
- Ether lipid metabolism (1)
- Glutathione metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Heparan sulfate biosynthesis (1)
- Non-homologous end-joining (1)
- Olfactory transduction (1)
- Pentose and glucuronate interconversions (1)
- RNA polymerase (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Steroid biosynthesis (1)
- Thiamine metabolism (1)
- alpha-Linolenic acid metabolism (1)