Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Goat Polyclonal Anti-ICAM1 (aa313-327) Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ICAM1 (aa313-327) Antibody: Peptide with sequence C-PNVILTKPEVSEGTE, from the internal region of the protein sequence according to NP_000192.2. |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit Polyclonal Anti-CLDN18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM |
Rabbit Polyclonal Anti-CLDN18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Thy-1 / CD90 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | THY1 / CD90 antibody was raised against synthetic peptide C-PEHTYRSRTNFTSKY from an internal region of human THY1 (NP_006279.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Panda, Dog, Horse (93%); Pig (87%); Elephant, Rabbit, Guinea pig (80%). |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
Rabbit anti-RAPGEF3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAPGEF3 |
CLDN3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CLDN3 |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit anti-MMP2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP2 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal Ezrin (Phospho-Tyr478) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ezrin around the phosphorylation site of tyrosine 478 (P-V-YP-E-P) |
| Modifications | Phospho-specific |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
CTNND1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNND1 |
Rabbit anti-THY1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human THY1 |
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Phospho-VASP-S239 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S239 of human VASP |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF |
Active filters
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Leukocyte transendothelial migration
Filter by
Category
Target Symbol
- CTNNB1 (21)
- EZR (20)
- ACTB (19)
- MAPK14 (18)
- PXN (16)
- PTPN11 (14)
- CXCR4 (13)
- ROCK2 (13)
- VASP (13)
- ICAM1 (12)
- PTK2 (12)
- PECAM1 (11)
- PRKCA (11)
- PRKCB (11)
- CLDN7 (10)
- MMP9 (10)
- PLCG1 (10)
- SHC1 (10)
- VCL (10)
- BCAR1 (9)
- CDH5 (9)
- CLDN1 (9)
- CTNNA1 (9)
- MMP2 (9)
- NCF1 (9)
- PIK3R1 (9)
- PLCG2 (9)
- PTK2B (9)
- CLDN5 (8)
- CTNND1 (8)
- ITGB1 (8)
- VAV1 (8)
- CLDN11 (7)
- CLDN3 (7)
- CLDN4 (7)
- CXCL12 (7)
- RHOA (7)
- VCAM1 (7)
- CLDN10 (6)
- CYBB (6)
- ITGA4 (6)
- ITGAM (6)
- MSN (6)
- THY1 (6)
- ACTG1 (5)
- ACTN1 (5)
- ACTN2 (5)
- ACTN4 (5)
- CDC42 (5)
- F11R (5)
- NOX1 (5)
- PRKCG (5)
- RAC1 (5)
- ROCK1 (5)
- SIPA1 (5)
- ACTN3 (4)
- CD99 (4)
- CLDN14 (4)
- CLDN19 (4)
- ITGB2 (4)
- MAPK12 (4)
- NCF4 (4)
- NOX3 (4)
- PIK3CA (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- RAP1A (4)
- RAPGEF3 (4)
- CLDN18 (3)
- CLDN2 (3)
- CLDN6 (3)
- CLDN8 (3)
- GNAI2 (3)
- GNAI3 (3)
- ITGAL (3)
- JAM2 (3)
- MYL9 (3)
- NCF2 (3)
- PIK3CD (3)
- RAP1B (3)
- VAV3 (3)
- ARHGAP35 (2)
- CLDN15 (2)
- CLDN16 (2)
- CLDN23 (2)
- CYBA (2)
- ITK (2)
- JAM3 (2)
- MAPK11 (2)
- MYL12B (2)
- MYL2 (2)
- RAC2 (2)
- RASSF5 (2)
- RHOH (2)
- VAV2 (2)
- AFDN (1)
- ARHGAP5 (1)
- CLDN17 (1)
- CLDN9 (1)
Reactivities
- Human (632)
- Mouse (471)
- Rat (396)
- Dog (27)
- Bovine (19)
- Chicken (15)
- Pig (15)
- Cow (13)
- Monkey (11)
- Rabbit (7)
- Canis (6)
- Rhesus Monkey (5)
- Xenopus (5)
- Canine (4)
- Drosophila (3)
- Sheep (3)
- Guinea Pig (2)
- Hamster (2)
- Horse (2)
- X. tropicalis (2)
- Zebrafish (2)
- Avian (1)
- Bat (1)
- C. elegans (1)
- Chimpanzee (1)
- Gibbon (1)
- Gorilla (1)
- Orang-Utan (1)
- Porcine (1)