Antibodies

View as table Download

Goat Polyclonal Antibody against FGF21

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal Antibody against CD14 (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14.

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

CD14 (71-84) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CD14 (NP_000582.1)

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

Rabbit Polyclonal Antibody against CD14 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14.

Rabbit polyclonal anti-KGF/FGF-7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human KGF/FGF-7

FGF10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF10

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

FGF4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (> 98 %) recombinant human FGF-4

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

EGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Anti-Human KGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human KGF (FGF-7)

FGF4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98 %) recombinant human FGF-4

FGF4 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98 %) recombinant human FGF-4

FGF4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Highly pure (> 98 %) recombinant human FGF-4

FGF4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of the human FGF4

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF

KGF (FGF7) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 64-94 amino acids from the Central region of human FGF7

Rabbit Polyclonal FGF4 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen FGF4 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human FGF4.

Rabbit polyclonal FGF4 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4.
EGF

USD 700.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody, Purified

Applications E(capture)
Reactivities Human
Immunogen Purified recombinant human EGF

FGF10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 167-197 amino acids from the C-terminal region of human FGF10

Goat Polyclonal Antibody against CD14

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRVDADADPRQYAD, from the internal region of the protein sequence according to NP_000582.1.

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Partial recombaint protein

Rabbit polyclonal anti-FGF-10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human FGF-10

Rabbit polyclonal anti-FGF-19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human FGF-19

Anti-Human FGF-4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-4

Anti-Human FGF-10 Goat Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-10

Biotinylated Anti-Human KGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human KGF (FGF-7)

Pro-EGF Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (near the N terminus) (SRQERVCNIEKNVS)

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pdgfc antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS

Rabbit anti CD14 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein encoding aa 1-201 of human CD14

Rabbit anti FGF 4 (NT) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine.

Rabbit anti FGF4 (IN) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine.

Rabbit anti FGF4 (NT1) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine.

Rabbit anti FGF4 (NT2) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine.

Anti-FGF7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-182 amino acids of Human Fibroblast growth factor 7

Anti-FGF7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-182 amino acids of Human Fibroblast growth factor 7

Anti-FGF4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4

Anti-EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor