Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
USD 380.00
In Stock
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
SPP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SPP1 |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinaint Chicken IL-1B |
Rabbit Polyclonal MD-2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MD-2 antibody was raised against a peptide corresponding to 13 amino acids near the center of human MD-2. The immunogen is located within the last 50 amino acids of MD-2. |
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
Rabbit anti-LY96 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LY96 |
Rabbit Polyclonal Anti-LBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-Osteopontin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
IL6 goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant human IL-6 |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
IL6 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinant Chicken IL-6. |
Osteopontin Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | SPP1 / Osteopontin antibody was raised against synthetic peptide C-DPKSKEEDKHLK from the C-terminus of human SPP1 / Osteopontin (NP_001035147.1; NP_000573.1; NP_001035149.1). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (92%); Mouse, Panda, Dog, Pig, Arthrobotrys (83%). |
Active filters
Clonalities
- Polyclonal
Families
- Secreted Protein
Pathways
- Toll-like receptor signaling pathway