Germany
Japan
United Kingdom
China
Antibodies
Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Immunogen | Human placental type IV Collagen. |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Active filters
Clonalities
- Polyclonal
Pathways
- Focal adhesion
Filter by
Target Symbol
- EGFR (81)
- AKT1 (61)
- KDR (37)
- CTNNB1 (35)
- ERBB2 (32)
- JUN (27)
- RAF1 (27)
- MAP2K1 (26)
- PAK1 (25)
- PTK2 (25)
- COL1A1 (24)
- BCL2 (23)
- MET (23)
- PXN (23)
- SRC (23)
- PDGFRB (22)
- MAPK8 (21)
- ACTB (20)
- BAD (20)
- BRAF (19)
- IGF1R (19)
- GSK3B (18)
- VASP (18)
- EGF (16)
- PDGFB (16)
- PRKCA (16)
- MAPK3 (15)
- ROCK2 (15)
- CCND1 (14)
- MAPK1 (14)
- PIK3R1 (14)
- AKT2 (13)
- ELK1 (13)
- IGF1 (13)
- ITGB3 (13)
- PTEN (13)
- SPP1 (13)
- VEGFA (13)
- CAV1 (12)
- COL5A1 (12)
- COL6A1 (12)
- FLT1 (12)
- PRKCB (12)
- FN1 (11)
- FYN (11)
- PDGFA (11)
- SHC1 (11)
- VCL (11)
- BCAR1 (10)
- GRB2 (10)
- ITGA6 (10)
- VAV1 (10)
- ITGA4 (9)
- ITGB1 (9)
- PDGFRA (9)
- PDPK1 (9)
- PGF (9)
- VEGFB (9)
- ACTN2 (8)
- AKT3 (8)
- COL1A2 (8)
- COL4A1 (8)
- CRK (8)
- PAK2 (8)
- ACTG1 (7)
- CAV2 (7)
- CCND3 (7)
- COL2A1 (7)
- ITGAV (7)
- PAK5 (7)
- RHOA (7)
- TNC (7)
- XIAP (7)
- ACTN1 (6)
- ACTN3 (6)
- CCND2 (6)
- CRKL (6)
- FLNA (6)
- FLT4 (6)
- ILK (6)
- ITGB4 (6)
- ITGB5 (6)
- PAK4 (6)
- PPP1CB (6)
- PPP1CC (6)
- PRKCG (6)
- ROCK1 (6)
- THBS1 (6)
- ZYX (6)
- ACTN4 (5)
- BIRC2 (5)
- CDC42 (5)
- COL3A1 (5)
- DOCK1 (5)
- HGF (5)
- ITGA2 (5)
- ITGA5 (5)
- LAMA4 (5)
- MAPK9 (5)
- PAK3 (5)
Reactivities
- Human (1157)
- Mouse (887)
- Rat (764)
- Bovine (38)
- Dog (35)
- Chicken (30)
- Pig (21)
- Monkey (18)
- Cow (14)
- Rabbit (12)
- Xenopus (11)
- Canine (9)
- Canis (8)
- Hamster (8)
- Horse (8)
- Rhesus Monkey (8)
- Drosophila (6)
- X. tropicalis (5)
- Bat (4)
- Sheep (4)
- Guinea Pig (3)
- C. elegans (2)
- Gorilla (2)
- Porcine (2)
- Zebrafish (2)
- Avian (1)
- Chimpanzee (1)
- Feline (1)
- Gibbon (1)
- Orang-Utan (1)
- Primate (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Conjugates
Modifications
Families
- Druggable Genome (1438)
- Protein Kinase (664)
- ES Cell Differentiation/IPS (543)
- Transmembrane (390)
- Secreted Protein (222)
- Stem cell relevant signaling - JAK/STAT signaling pathway (118)
- Stem cell - Pluripotency (112)
- Adult stem cells (107)
- Transcription Factors (93)
- Cancer stem cells (81)
- Phosphatase (30)
- Embryonic stem cells (21)
- Induced pluripotent stem cells (21)
- Stem cell relevant signaling - DSL/Notch pathway (14)
- Stem cell relevant signaling - Wnt Signaling pathway (14)
- Protease (7)