Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Pathways
- Focal adhesion
Filter by
Category
Target Symbol
- AKT1 (47)
- EGFR (29)
- JUN (21)
- CTNNB1 (19)
- ACTB (16)
- ERBB2 (16)
- RAF1 (16)
- IGF1R (15)
- MAP2K1 (14)
- GSK3B (13)
- MAPK1 (13)
- PAK1 (13)
- SRC (13)
- KDR (12)
- MET (12)
- PTK2 (12)
- PXN (12)
- BAD (11)
- BRAF (11)
- MAPK8 (11)
- PDGFRB (11)
- ROCK2 (11)
- MAPK3 (10)
- PRKCA (10)
- VASP (10)
- AKT2 (9)
- ELK1 (9)
- PIK3R1 (9)
- PTEN (9)
- VCL (9)
- BCAR1 (8)
- BCL2 (8)
- PRKCB (8)
- SPP1 (8)
- CCND1 (7)
- PAK2 (7)
- RHOA (7)
- SHC1 (7)
- CAV1 (6)
- CCND3 (6)
- PDGFRA (6)
- VAV1 (6)
- VEGFA (6)
- VEGFB (6)
- AKT3 (5)
- CCND2 (5)
- FLT1 (5)
- IGF1 (5)
- ITGB1 (5)
- ITGB4 (5)
- PDGFB (5)
- PDPK1 (5)
- PPP1CB (5)
- XIAP (5)
- ACTN1 (4)
- CDC42 (4)
- COL2A1 (4)
- COL3A1 (4)
- FLNA (4)
- FN1 (4)
- FYN (4)
- GRB2 (4)
- ILK (4)
- ITGB3 (4)
- MAPK10 (4)
- PAK3 (4)
- RAC1 (4)
- ROCK1 (4)
- ACTG1 (3)
- ACTN3 (3)
- BIRC2 (3)
- CRK (3)
- EGF (3)
- HGF (3)
- ITGA4 (3)
- ITGB5 (3)
- LAMA1 (3)
- PAK4 (3)
- PAK5 (3)
- PDGFA (3)
- PPP1R12A (3)
- PRKCG (3)
- RAP1A (3)
- THBS1 (3)
- ACTN2 (2)
- ACTN4 (2)
- ARHGAP35 (2)
- CAPN2 (2)
- CAV3 (2)
- COL1A2 (2)
- COL4A1 (2)
- COMP (2)
- CRKL (2)
- DOCK1 (2)
- HRAS (2)
- ITGA7 (2)
- ITGAV (2)
- LAMA3 (2)
- MAPK9 (2)
- MYL2 (2)
Applications
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (721)
- Protein Kinase (370)
- ES Cell Differentiation/IPS (270)
- Transmembrane (148)
- Secreted Protein (82)
- Transcription Factors (58)
- Stem cell - Pluripotency (55)
- Stem cell relevant signaling - JAK/STAT signaling pathway (49)
- Adult stem cells (37)
- Cancer stem cells (29)
- Phosphatase (18)
- Stem cell relevant signaling - DSL/Notch pathway (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)
- Embryonic stem cells (5)
- Induced pluripotent stem cells (5)
- Protease (5)