Antibodies

View as table Download

XRCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC4

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A

Rabbit anti-XRCC5 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC5

Rabbit polyclonal anti-DNA-PK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DNA-PK.

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.

Rabbit Polyclonal Ku80 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426)

Rabbit polyclonal anti-XRCC6 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC6.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal XRCC5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC5.

Rabbit Polyclonal Anti-Ku70 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70

Rabbit Polyclonal Anti-Ku70 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70

Rabbit Polyclonal Anti-DNA-PK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA-PK Antibody: A synthesized peptide derived from human DNA-PK

Rabbit Polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A

Rabbit Polyclonal Anti-DNA PK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA PK Antibody: A synthesized peptide derived from human DNA PK

Rabbit Polyclonal Anti-Ku70/80 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70/80 Antibody: A synthesized peptide derived from human Ku70/80

Rabbit Polyclonal Antibody against Mre11

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein

Rabbit polyclonal anti-XRCC6 / Ku70/80 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70/80.
Modifications Phospho-specific

Rabbit polyclonal DNA Polymerase lambda antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?.

Anti-RAD50 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit polyclonal anti-RAD50 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD50.

Anti-LIG4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ligase IV, DNA, ATP-dependent

Goat Anti-POLL / BETA-N Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1.

Rabbit polyclonal anti-Mre11 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein.

Rabbit Polyclonal Anti-XRCC4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC4 antibody: synthetic peptide directed towards the middle region of human XRCC4. Synthetic peptide located within the following region: LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Anti-XRCC6 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human X-ray repair complementing defective repair in Chinese hamster cells 6

Anti-XRCC6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human X-ray repair complementing defective repair in Chinese hamster cells 6

Anti-RAD50 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MRE11A

Rabbit polyclonal anti-NHEJ1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NHEJ1

Rabbit polyclonal anti-NHEJ1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NHEJ1