Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit anti-CTSD Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human CTSD |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit anti-CTSH Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTSH |
Rabbit anti-TPP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TPP1 |
Rabbit Polyclonal Anti-Cathepsin G Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G |
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gly65) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cathepsin D AND light chain. |
Rabbit polyclonal Cathepsin D (heavy chain, Cleaved-Leu169) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATD. |
Rabbit polyclonal anti-Cathepsin D antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CTSD. |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit polyclonal CATL2 (Cleaved-Leu114) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL2. |
Rabbit polyclonal CATZ (Cleaved-Leu62) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATZ. |
Cathepsin D (CTSD) rabbit polyclonal antibody, Aff - Purified
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 140 of Mouse Cathepsins D |
Goat Polyclonal Antibody against CTSK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1. |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gln161) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CTSD. |
Rabbit polyclonal CATG (Cleaved-Ile21) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATG. |
Rabbit Polyclonal Anti-CTSC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSC antibody is: synthetic peptide directed towards the N-terminal region of Human CTSC. Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD |
Rabbit Polyclonal Anti-CTSS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH |
Rabbit anti Legumain Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat. |
Goat Polyclonal Antibody against CTSF
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CGVNTMASSAVVD, from the C Terminus of the protein sequence according to NP_003784.2. |
Goat Anti-CLN2 / TPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TPSVIRKRYNLTSQD, from the internal region of the protein sequence according to NP_000382.3. |
Rabbit Polyclonal antibody to Cathepsin D (cathepsin D)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 72 and 292 of Cathepsin D (Uniprot ID#P07339) |
Rabbit polyclonal Dipeptidyl-peptidase 1 (heavy chain, Cleaved-Arg394) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Dipeptidyl-peptidase 1. |
Rabbit polyclonal anti-Cathepsin L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 223 of human Cathepsin L |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN |
Rabbit Polyclonal Anti-CTSC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSC antibody: synthetic peptide directed towards the middle region of human CTSC. Synthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS |
Rabbit Polyclonal Anti-CTSK Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY |
Rabbit anti Cathepsin D Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-CTSZ Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 62-303 amino acids of Human Cathepsin Z |
Anti-CTSG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G |
Anti-CTSH Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 116-335 amino acids of human cathepsin H |
Anti-CTSE Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 57-367 amino acids of Human Cathepsin E |
Anti-CTSB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B |
Anti-AGA Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Families
- Protease
Pathways
- Lysosome