Antibodies

View as table Download

BTK Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BTK

Phospho-ZAP70-Y493 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y493 of human ZAP70
Modifications Phospho-specific

Rabbit anti-ZAP70 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZAP70

Phospho-ZAP70-Y319 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y319 of human ZAP70
Modifications Phospho-specific

Rabbit Polyclonal Anti-Phospho-BTK(Tyr223) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-BTK(Tyr223) Antibody: A synthesized peptide derived from human BTK around the phosphorylation site of Tyrosine 223
Modifications Phospho-specific

JAK3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

BTK (91-387) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant Human Btk, protein fragment containing a sequence corresponding to a region with amino acids 91 and 387 of Human Btk

Rabbit polyclonal LCK Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK.

ZAP70 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

ZAP70 pTyr319 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from Human ZAP70 around the phosphorylation site of Tyrosine 319.

ZAP70 pTyr493 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal BTK (Tyr223) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 223 (A-L-YP-D-Y).
Modifications Phospho-specific

Rabbit polyclonal ZAP70 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70.

Rabbit polyclonal LCK Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK.

Rabbit Polyclonal Lck Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck

Rabbit Polyclonal Lck Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck

Rabbit Polyclonal Lck (Tyr393) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 393
Modifications Phospho-specific

Rabbit Polyclonal ZAP-70 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ZAP-70

Mouse Monoclonal BTK Antibody (7F12H4)

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
TA336560 is a replacement of AM06170SU-N.

BTK rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

LCK rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal BTK Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BTK antibody was raised against a synthetic peptide corresponding to 16 amino acids near the amino-terminus of human BTK.

Rabbit Polyclonal BTK [p Tyr223] Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide made to a peptide surrounding amino acid 223 of the human BTK protein (between residues 200-250) [UniProt Q06187]

Rabbit anti-ZAP70 (Phospho-Tyr319) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanZap-70 around the phosphorylation site of tyrosine 319 (S-P-YP-S-D).
Modifications Phospho-specific

Rabbit polyclonal LCK (Ser59) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human LCK around the phosphorylation site of serine 59 (P-A-SP-P-L).
Modifications Phospho-specific

Rabbit polyclonal Lck (Tyr393) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Lck around the phosphorylation site of tyrosine 393 (N-E-YP-T-A).
Modifications Phospho-specific

Rabbit polyclonal Zap-70 (Tyr319) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Zap-70 around the phosphorylation site of tyrosine 319 (S-P-YP-S-D).
Modifications Phospho-specific

Rabbit polyclonal BTK (Ab-222) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 222 (A-L-YP-D-Y).

Anti-LCK (Phospho-Tyr394) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 394 (N-E-Y(p)-T-A) derived from Human Lck.
Modifications Phospho-specific

Anti-LCK Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.392-396(N-E-Y-T-A) derived from Human Lck.

Anti-ZAP70 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.317~321 (S-P-Y-S-D) derived from Human ZAP70.

Rabbit Polyclonal Lck (Tyr505) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 505
Modifications Phospho-specific

Rabbit Polyclonal ZAP-70 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ZAP-70

Rabbit Polyclonal ZAP-70 (Tyr319) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ZAP-70 around the phosphorylation site of Tyrosine 319
Modifications Phospho-specific

Rabbit Polyclonal ZAP-70 (Tyr493) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ZAP-70 around the phosphorylation site of Tyrosine 493
Modifications Phospho-specific

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE

Mouse Monoclonal ZAP-70 Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

LCK pTyr505 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Peptide sequence around the phosphorylation site of Tyrosine 505 (G-Q-Yp-Q-P) derived from Human LCK.

LCK pTyr505 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Peptide sequence around the phosphorylation site of Tyrosine 505 (G-Q-Yp-Q-P) derived from Human LCK.

LCK rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit anti-ZAP70 (Phospho-Tyr493) polyclonal antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanZap-70 around the phosphorylation site of tyrosine 493 (S-Y-YP-T-A).
Modifications Phospho-specific

Goat Anti-LCK (aa39-52) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNGSEVRDPLVTYE, from the internal region (near N Terminus) of the protein sequence according to NP_005347.3.

Rabbit polyclonal LCK (Ab-59) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human LCK around the phosphorylation site of serine 59 (P-A-SP-P-L).

Rabbit polyclonal BTK (Tyr551) antibody(Phospho-specific)

Applications WB
Reactivities Human: Tyr551, Mouse: Tyr551, Rat:Tyr552
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 551 (D-E-YP-T-S).
Modifications Phospho-specific

Anti-LCK (phospho-Tyr505) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 505 (G-Q-Y(p)-Q-P) derived from Human Lck.
Modifications Phospho-specific

Mouse monoclonal LCK Antibody(Ascites)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Mouse Monoclonal BTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal BTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated