Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
IL12A mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-61, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 257, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 807, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free
| Applications | FC |
| Reactivities | Human |
IL12A mouse monoclonal antibody, clone B-T21, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free
| Reactivities | Human |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Interferon beta Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Rabbit Polyclonal CXCL10/INP10 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
IL12B mouse monoclonal antibody, clone B-P24, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
IL12B mouse monoclonal antibody, clone B-P24, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
IL8 (CXCL8) mouse monoclonal antibody, clone B-K8, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
IL12A goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Human, Monkey |
| Immunogen | Synthetic peptide from human IL12A / p35 |
IL12A (alpha + beta) goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hIL?12 (human Interleukin-12). |
Active filters
Families
- Secreted Protein
Pathways
- RIG-I-like receptor signaling pathway