Mouse monoclonal anti-PARP antibody, clone 7A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal anti-PARP antibody, clone 7A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-PARP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PARP1 |
Rabbit Polyclonal Anti-HMGB1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
Goat Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit anti-APEX1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APEX1 |
Rabbit polyclonal anti-PCNA antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PCNA |
Goat Polyclonal Anti-MUTYH Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 476 aa to the C-terminus of human Mutyh produced in E. coli. |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
HMG1 (HMGB1) mouse monoclonal antibody, clone J2E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against APE1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
HMG1 / HMGB1 Mouse Monoclonal (IMG19N10B7) Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MUTYH Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MUTYH Antibody: A synthesized peptide derived from human MUTYH |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit polyclonal anti-HMGB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HMGB1. |
Rabbit polyclonal anti-PCNA antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PCNA. |
Rabbit polyclonal anti-FEN1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FEN1. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Cleaved-PARP antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PARP |
Rabbit anti-HMGB1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HMGB1 |
Rabbit Polyclonal Anti-POLD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
HMG1 (HMGB1) mouse monoclonal antibody, clone J2E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
PCNA mouse monoclonal antibody, clone IML-83, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
MYH (MUTYH) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APE1 (APEX1) (2-15) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from N Terminus of APE1 / APEX1 - KLH conjugated |
MYH (MUTYH) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 352-381aa) of human MUTYH. |
Mouse Monoclonal Antibody against APEX1 (13B8E5C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1. |
Rabbit polyclonal antibody to APE1 (APEX nuclease (multifunctional DNA repair enzyme) 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of APE1 (Uniprot ID#P27695) |
Rabbit polyclonal anti-UNG antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UNG. |
Rabbit polyclonal PARP (Cleaved-Gly215) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PARP. |
Rabbit polyclonal APEX1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APEX1. |
Rabbit anti-FEN1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FEN1 |
Rabbit Polyclonal HMGB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human HMGB1. |
Mouse Monoclonal HMGB1/HMG-1 Antibody (19N12A1)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal MYH Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PARP1 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | PARP1 antibody was raised against a synthetic peptide derived from N-terminus of human PARP protein |
PARP1 (396-412) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Canine, Equine, Human, Monkey |
Immunogen | KLH conjugated synthetic peptide comprising amino acids 396 - 412 of the human ADP-ribosyltransferase (ADPRT) protein |
APE1 (APEX1) rabbit polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Human |
PARP1 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide for the N-terminal region of human PARP. |
Goat Polyclonal Antibody against APE1 / APEX1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PKRGKKGAVAEDGD-C, from the N Terminus of the protein sequence according to NP_001632.2; NP_542379.1; NP_542380.1. |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Mouse Monoclonal PCNA Antibody (PC10)
Applications | IHC, WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal anti-MUTYH antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MUTYH. |
Rabbit Polyclonal UNG2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | UNG2 antibody was raised against a 17 amino acid peptide near the amino terminus of human UNG2. |
Rabbit polyclonal FEN1 Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |