Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Goat Polyclonal Anti-AIFM1 (aa183-195) Antibody
| Applications | IF, WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AIFM1 (aa183-195) Antibody: Peptide with sequence C-DDPNVTKTLRFKQ, from the internal region of the protein sequence according to NP_004199.1; NP_665811.1; NP_001124319.1. |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-PFN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Active filters
Isotypes
- IgG
Pathways
- Regulation of actin cytoskeleton
Filter by
Category
Target Symbol
- EGFR (51)
- EZR (20)
- BRAF (18)
- RAF1 (17)
- ACTB (16)
- PXN (15)
- MAPK1 (14)
- PDGFRB (14)
- ROCK2 (14)
- PAK1 (13)
- VCL (13)
- FGFR1 (12)
- MAP2K1 (12)
- PTK2 (12)
- ITGB3 (11)
- MAPK3 (11)
- PDGFB (11)
- FN1 (10)
- LIMK2 (10)
- NCF1 (10)
- SHC1 (10)
- BCAR1 (9)
- CFL1 (9)
- F2R (9)
- FGF4 (9)
- FGFR2 (9)
- LIMK1 (9)
- APC (8)
- EGF (8)
- FGF2 (8)
- ITGAV (8)
- FGF1 (7)
- FGFR3 (7)
- MAP2K2 (7)
- NRAS (7)
- PAK2 (7)
- PAK5 (7)
- PDGFRA (7)
- PIK3R1 (7)
- PPP1CB (7)
- RHOA (7)
- VAV1 (7)
- ACTN1 (6)
- CHRM1 (6)
- ITGA4 (6)
- ITGB1 (6)
- ITGB2 (6)
- MSN (6)
- PDGFA (6)
- ROCK1 (6)
- ACTN2 (5)
- ACTN3 (5)
- ACTN4 (5)
- BAIAP2 (5)
- BDKRB1 (5)
- CSK (5)
- F2 (5)
- FGF23 (5)
- FGF7 (5)
- GSN (5)
- ITGA6 (5)
- ITGB4 (5)
- PAK4 (5)
- PDGFC (5)
- PFN1 (5)
- PIK3CD (5)
- PPP1CC (5)
- RDX (5)
- ACTG1 (4)
- ARAF (4)
- ARPC2 (4)
- ARPC3 (4)
- CDC42 (4)
- CFL2 (4)
- CRKL (4)
- DOCK1 (4)
- FGF18 (4)
- GNA13 (4)
- ITGA5 (4)
- ITGAX (4)
- ITGB5 (4)
- PAK3 (4)
- PIK3CB (4)
- PIK3R3 (4)
- PPP1CA (4)
- PPP1R12A (4)
- RAC1 (4)
- RRAS2 (4)
- WAS (4)
- ARHGEF1 (3)
- ARHGEF7 (3)
- ARPC1A (3)
- ARPC1B (3)
- BDKRB2 (3)
- CD14 (3)
- CHRM2 (3)
- CHRM5 (3)
- CRK (3)
- FGF10 (3)
- FGF13 (3)
Reactivities
- Human (850)
- Mouse (628)
- Rat (545)
- Dog (32)
- Bovine (27)
- Chicken (26)
- Pig (16)
- Monkey (13)
- Rabbit (12)
- Cow (11)
- Rhesus Monkey (10)
- Canis (8)
- Xenopus (6)
- Drosophila (5)
- Canine (4)
- X. tropicalis (4)
- Zebrafish (4)
- Gorilla (3)
- Chimpanzee (2)
- Guinea Pig (2)
- Hamster (2)
- Horse (2)
- Orang-Utan (2)
- Sheep (2)
- All Species (1)
- Bat (1)
- Gibbon (1)
- Primate (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (781)
- Protein Kinase (288)
- Transmembrane (234)
- ES Cell Differentiation/IPS (211)
- Secreted Protein (148)
- Adult stem cells (87)
- Cancer stem cells (51)
- Stem cell relevant signaling - JAK/STAT signaling pathway (51)
- Stem cell - Pluripotency (39)
- Embryonic stem cells (36)
- GPCR (30)
- Induced pluripotent stem cells (22)
- Phosphatase (18)
- Transcription Factors (13)
- Stem cell relevant signaling - Wnt Signaling pathway (9)
- Protease (5)