Germany
Japan
United Kingdom
China
Antibodies
Download
USD 250.00
2 Weeks
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Birds, Mammalian, Yeast |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Chicken polyclonal anti-TUBA1A(alpha Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Rat |
| Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
USD 420.00
In Stock
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TJP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Mouse Monoclonal beta Tubulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 429 of beta Tubulin |
Active filters
Pathways
- Gap junction
Filter by
Target Symbol
- MAP2K1 (237)
- EGFR (207)
- MAPK1 (74)
- PDGFRA (63)
- KRAS (58)
- MAPK7 (57)
- PDGFRB (50)
- TUBAL3 (50)
- GNAS (48)
- HRAS (47)
- EGF (38)
- MAP2K2 (34)
- RAF1 (33)
- TUBB2B (32)
- TUBB4A (32)
- TUBA8 (31)
- SRC (30)
- PRKCA (27)
- CDK1 (23)
- MAPK3 (23)
- GJA1 (20)
- TUBA1A (20)
- TUBA1B (20)
- NRAS (17)
- PDGFB (16)
- PRKG1 (15)
- TUBA3E (15)
- TUBB1 (15)
- TUBB2A (15)
- PRKG2 (14)
- PRKCB (12)
- TUBB (12)
- TUBB3 (12)
- GRB2 (11)
- PDGFA (11)
- TUBA4A (11)
- GNAI1 (10)
- LPAR1 (9)
- GRM1 (8)
- HTR2C (8)
- PRKACA (8)
- TUBA1C (8)
- DRD1 (7)
- GRM5 (7)
- HTR2B (7)
- TJP1 (7)
- CDC2 (6)
- PDGFD (6)
- PRKCG (6)
- ADRB1 (5)
- DRD2 (5)
- PDGFC (5)
- TUBA3C (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- GNA11 (4)
- GNAI2 (4)
- GUCY1B1 (4)
- PLCB3 (4)
- PRKACB (4)
- ADCY2 (3)
- ADCY6 (3)
- CSNK1D (3)
- GJD2 (3)
- GNAI3 (3)
- HTR2A (3)
- MAP2K5 (3)
- PLCB1 (3)
- PRKACG (3)
- PRKX (3)
- SOS2 (3)
- ADCY3 (2)
- ADCY8 (2)
- GNAQ (2)
- GUCY1A1 (2)
- ITPR2 (2)
- MAP3K2 (2)
- PLCB2 (2)
- SOS1 (2)
- TUBA3D (2)
- TUBB6 (2)
- ADCY7 (1)
- ADCY9 (1)
- GUCY1A2 (1)
- GUCY1A3 (1)
- GUCY1B3 (1)
- ITPR1 (1)
- ITPR3 (1)
- TUBB4Q (1)
- TUBB8 (1)
Reactivities
- Human (1412)
- Mouse (1194)
- Rat (1153)
- Dog (298)
- Monkey (289)
- Bovine (29)
- Chicken (23)
- Xenopus (14)
- Canine (12)
- Pig (12)
- Rabbit (7)
- Hamster (6)
- Bat (5)
- Chimpanzee (5)
- Cow (5)
- Drosophila (5)
- Horse (5)
- Rhesus Monkey (5)
- Porcine (4)
- Gorilla (3)
- Zebrafish (3)
- All Species (2)
- Canis (2)
- Dictyostelium (2)
- Mammalian (2)
- Primate (2)
- X. tropicalis (2)
- Chlamydomonas (1)
- Feline (1)
- Fish (1)
- Frog (1)
- Goat (1)
- Guinea Pig (1)
- Murine (1)
- Sheep (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1622)
- Protein Kinase (937)
- Transmembrane (468)
- ES Cell Differentiation/IPS (455)
- Secreted Protein (261)
- Adult stem cells (250)
- Stem cell relevant signaling - JAK/STAT signaling pathway (237)
- Cancer stem cells (207)
- GPCR (52)
- Embryonic stem cells (43)
- Induced pluripotent stem cells (43)
- Stem cell - Pluripotency (34)
- Ion Channels: Other (23)