Germany
Japan
United Kingdom
China
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10264, Purified
| Applications | ELISA |
| Reactivities | Human |
Antibodies
DownloadFSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10243, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Adenosine Receptor A2a (ADORA2A) (full length) Mouse Monoclonal Antibody [Clone ID: 7F6-G5-A2 / 7F6]
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
PBR (TSPO) (C-term) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide C-RDNSGRRGGSRLPE from the C-terminus of Mouse TSPO (NP_033905.3). Percent identity with other species by BLAST analysis: Mouse (100%), Rat (93%). C-Terminus |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor. |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Rat |
| Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4 |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
GRIA3 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA3 |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Goat Anti-GRIK3 / GLUR7 Antibody
| Applications | WB |
| Reactivities | Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KIRQLPIDSDDSRP, from the internal region of the protein sequence according to NP_000822.2. |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit polyclonal anti-TSPO/PBR (Peripheral-type Benzodiazepine Receptor) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 81 of mouse PBR |
USD 395.00
2 Weeks
Luteinizing Hormone beta (LHB) mouse monoclonal antibody, clone 090-11412, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal anti-MTR1A antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MTR1A. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Neuroactive ligand-receptor interaction
Filter by
Target Symbol
- FSHB (74)
- NR3C1 (68)
- PRL (49)
- THRA (44)
- CSH1 (40)
- GABRA5 (22)
- GPR83 (19)
- GRIN1 (19)
- GRIN2B (18)
- F2 (17)
- PLG (17)
- GRIA1 (15)
- LHB (15)
- F2R (14)
- ADRA1B (13)
- LEP (13)
- SSTR3 (13)
- ADRB2 (12)
- GH1 (12)
- GRIA2 (12)
- THRB (12)
- CRHR1 (11)
- CRHR2 (11)
- HCRTR1 (11)
- HTR4 (11)
- NTSR1 (11)
- P2RX2 (11)
- CGA (10)
- FPR1 (10)
- GABBR1 (10)
- GH2 (10)
- GRM4 (10)
- GRM7 (10)
- HTR7 (10)
- PTGER3 (10)
- SSTR1 (10)
- C5AR1 (9)
- CCKAR (9)
- FPR2 (9)
- GRM3 (9)
- HTR5A (9)
- LPAR1 (9)
- LPAR4 (9)
- NPY1R (9)
- S1PR1 (9)
- SSTR2 (9)
- SSTR4 (9)
- SSTR5 (9)
- TRPV1 (9)
- TSHR (9)
- ADORA2A (8)
- ADRA2A (8)
- APLNR (8)
- CHRM1 (8)
- CNR2 (8)
- GABRB1 (8)
- GHRHR (8)
- GRIN2A (8)
- GRM1 (8)
- GRM2 (8)
- HRH3 (8)
- HTR1F (8)
- HTR2C (8)
- P2RY2 (8)
- ADRA2C (7)
- AVPR1B (7)
- BDKRB1 (7)
- CYSLTR1 (7)
- DRD1 (7)
- GABRB3 (7)
- GIPR (7)
- GRIK1 (7)
- GRM5 (7)
- GRM8 (7)
- HTR1A (7)
- HTR2B (7)
- KISS1R (7)
- NPY2R (7)
- OPRD1 (7)
- OPRM1 (7)
- PTGER2 (7)
- RXFP1 (7)
- S1PR3 (7)
- ADRA1A (6)
- ADRB3 (6)
- AGTR1 (6)
- AVPR1A (6)
- BRS3 (6)
- CYSLTR2 (6)
- FSHR (6)
- GABRA3 (6)
- GHSR (6)
- GLP2R (6)
- GLRA1 (6)
- GNRHR (6)
- GPR50 (6)
- GRPR (6)
- HRH1 (6)
- HRH2 (6)
- HRH4 (6)
Reactivities
- Human (1358)
- Mouse (741)
- Rat (650)
- Monkey (76)
- Dog (66)
- Bovine (40)
- Gorilla (39)
- Rabbit (36)
- Pig (32)
- Bat (30)
- Horse (29)
- Gibbon (27)
- Hamster (23)
- Cow (22)
- Chimpanzee (12)
- Guinea Pig (11)
- Chicken (9)
- Rhesus Monkey (8)
- Primate (7)
- Xenopus (6)
- Orang-Utan (5)
- Canine (4)
- Sheep (2)
- Zebrafish (2)
- Feline (1)
- Goat (1)
- Macaque (1)
- Murine (1)
- X. tropicalis (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1703)
- Transmembrane (1288)
- GPCR (939)
- Secreted Protein (246)
- Transcription Factors (134)
- Nuclear Hormone Receptor (124)
- Ion Channels: Glutamate Receptors (115)
- Ion Channels: Cys-loop Receptors (91)
- Protease (44)
- ES Cell Differentiation/IPS (32)
- Ion Channels: ATP Receptors (27)
- Ion Channels: Transient receptor potential (9)
- Ion Channels: Sodium (8)