Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal Anti-EXOSC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
Rabbit Polyclonal Anti-LSM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Rabbit Polyclonal Anti-EXOSC6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
Rabbit Polyclonal Anti-RQCD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK |
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN |
Rabbit Polyclonal Anti-LSM4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK |
Rabbit Polyclonal Anti-EXOSC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV |
Rabbit Polyclonal Anti-EXOSC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD |
Rabbit Polyclonal Anti-EXOSC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |
Rabbit Polyclonal Anti-EXOSC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES |
Rabbit Polyclonal Anti-EXOSC10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
Rabbit Polyclonal Anti-EXOSC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3. Synthetic peptide located within the following region: TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK |
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR |
Rabbit Polyclonal PAPOLA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLA antibody: human PAPOLA (polyA polymerase alpha), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit anti-MTR4 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MTR4 |
Rabbit Polyclonal Anti-EXOSC10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C-terminal region of human EXOSC10. Synthetic peptide located within the following region: ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP |
Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal Anti-CNOT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the N terminal of human CNOT7. Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP |
Rabbit Polyclonal Anti-POLS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLS antibody: synthetic peptide directed towards the N terminal of human POLS. Synthetic peptide located within the following region: VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
USD 475.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL |
Rabbit Polyclonal Anti-LSM6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE |
Rabbit Polyclonal Anti-XRN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRN1 antibody: synthetic peptide directed towards the middle region of human XRN1. Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM |
USD 385.00
2 Weeks
Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
NSE (ENO2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide mapping at the C-terminus of NSE of human origin |
Goat Polyclonal Antibody against DEAD-box protein 6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1. |
Rabbit polyclonal CAF-1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal CNOT8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Active filters
Pathways
- RNA degradation
Filter by
Category
Target Symbol
- CNOT4 (70)
- HSPD1 (55)
- PARN (48)
- EXOSC7 (37)
- WDR61 (33)
- ENO2 (32)
- DCP1B (27)
- LSM1 (26)
- HSPA9 (24)
- EXOSC1 (20)
- CNOT2 (19)
- DDX6 (19)
- C1D (18)
- EXOSC3 (14)
- ENO1 (13)
- DCPS (10)
- DCP1A (8)
- XRN2 (7)
- ENO3 (6)
- DCP2 (5)
- PNPT1 (5)
- CNOT3 (4)
- CNOT7 (4)
- DIS3 (4)
- EXOSC2 (3)
- EXOSC9 (3)
- CNOT10 (2)
- CNOT8 (2)
- EDC3 (2)
- EXOSC10 (2)
- EXOSC6 (2)
- LSM2 (2)
- LSM4 (2)
- LSM6 (2)
- MTREX (2)
- PAPOLA (2)
- PAPOLB (2)
- SKIV2L (2)
- CNOT6 (1)
- CNOT6L (1)
- CNOT9 (1)
- EDC4 (1)
- EXOSC4 (1)
- LSM5 (1)
- LSM7 (1)
- LSM8 (1)
- MPHOSPH6 (1)
- PAPOLG (1)
- PATL1 (1)
- SKIV2L2 (1)
- TENT4A (1)
- XRN1 (1)
- ZCCHC7 (1)
Reactivities
- Human (520)
- Mouse (421)
- Rat (389)
- Dog (47)
- Monkey (45)
- Bovine (9)
- Chicken (8)
- Hamster (6)
- Xenopus (4)
- Canine (3)
- Pig (3)
- Primate (3)
- Rabbit (3)
- Cow (2)
- Guinea Pig (2)
- Chimpanzee (1)
- Drosophila (1)
- Escherichia coli (1)
- Helicobacter pylori (1)
- Rhesus Monkey (1)
- Salmonella Typhimurium (1)
- Sheep (1)
- Spinach (1)
- Trichinella spiralis (1)
- White Fly (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)