Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Vinculin Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 767-1066 of human Vinculin (NP_003364.1). |
| Modifications | Unmodified |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Vinculin (VCL) mouse monoclonal antibody, clone VIN-54, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Anti-vinculin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin |
Mouse Monoclonal Anti-Vinculin Antibody [7E10]
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Vinculin (Tyr821) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Vinculin around the phosphorylation site of Tyrosine 821 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Vinculin Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Vinculin |
Rabbit Polyclonal Anti-VCL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA |
Rabbit Polyclonal Anti-Vinculin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin. |
Mouse Monoclonal Anti-Vinculin Antibody [8B5]
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Anti-VCL Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 811-824 amino acids of human vinculin |
Vinculin Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Vinculin |
Active filters
Target Symbol
- VCL