Germany
Japan
United Kingdom
China
LRP6 (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit, Rat |
| Immunogen | Synthetic peptide from an internal region of human LRP6 (NP_002327.2) |
WNT Pathway Markers-Antibodies
View as table Download
Apolipoprotein CII (APOC2) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | ApoLipoprotein Type C-II produced synthetically in full-length form (not selected epitopes) using conventional peptide technology |
Apc11 (ANAPC11) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH. |
Apc2 (ANAPC2) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 810-822 of Human APC2 (C-terminal) coupled to KLH. |
Rabbit Polyclonal Antibody against LRP6 (C-term T1546)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LRP6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1531-1560 amino acids from the C-terminal region of human LRP6. |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Goat Polyclonal Antibody against FZD4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DEEERRCDPIRIS, from the internal region of the protein sequence according to NP_036325.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal anti-ROR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ROR2. |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Anti-ROR1 Goat Polyclonal () Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit Polyclonal Anti-TCF21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF21 Antibody: synthetic peptide directed towards the N terminal of human TCF21. Synthetic peptide located within the following region: SNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERAR |
Rabbit Polyclonal Anti-FZD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
Rabbit Polyclonal Anti-FZD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
Rabbit Polyclonal Anti-Wnt11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt11 antibody is: synthetic peptide directed towards the middle region of Mouse Wnt11. Synthetic peptide located within the following region: PGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQA |
Rabbit Polyclonal Anti-FZD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Rabbit Polyclonal Anti-Wnt10a Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt10a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Rabbit Polyclonal Anti-FZD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD8 antibody: synthetic peptide directed towards the N terminal of human FZD8. Synthetic peptide located within the following region: PDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHR |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-NULP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NULP1 antibody is: synthetic peptide directed towards the N-terminal region of Human NULP1. Synthetic peptide located within the following region: DLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDLEDDPVV |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
ROCK2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ROCK2 |
Rabbit Polyclonal JNK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
JNK1 (MAPK8) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide mapping to the C-terminus of human JNK-1 |
WNT3A rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
FZD5/FZD8 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 42-90 of Human Frizzled-5. |
FZD3 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse |
Frizzled 2 (FZD2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 208-260 of Human Frizzled-2. |
MEK4 (MAP2K4) pSer80 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E). |
MEK4 (MAP2K4) pSer80 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E). |
JNK1/2/3 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human JNK1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Clonalities
- Polyclonal
Filter by
Target Symbol
- MAPK8 (28)
- ROCK2 (17)
- RORA (13)
- WNT1 (12)
- FZD4 (11)
- LEF1 (10)
- WNT2B (10)
- ANAPC5 (9)
- LRP6 (9)
- ROCK1 (9)
- FZD2 (8)
- TCF25 (8)
- WNT10A (8)
- WNT5B (8)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- LRP5 (7)
- ROR1 (7)
- TCF4 (7)
- WNT16 (7)
- WNT2 (7)
- WNT4 (7)
- WNT6 (7)
- ANAPC10 (6)
- DVL2 (6)
- FZD10 (6)
- TCF7L2 (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- PTK7 (5)
- WNT11 (5)
- WNT3A (5)
- WNT5A (5)
- ANAPC13 (4)
- MAPK10 (4)
- MAPK9 (4)
- TCF21 (4)
- ANAPC11 (3)
- ANAPC15 (3)
- ANAPC2 (3)
- APC2 (3)
- FZD7 (3)
- INTS1 (3)
- ROR2 (3)
- WNT7A (3)
- MAP2K4 (2)
- SLC25A23 (2)
- WNT3 (2)
- WNT7B (2)
- APOC2 (1)
- DVL1 (1)
- JKK-1 (1)
- LRP5L (1)
- MAP2K7 (1)
- RYK (1)
Reactivities
- Human (293)
- Mouse (203)
- Rat (149)
- Bovine (23)
- Dog (16)
- Monkey (14)
- Chicken (12)
- Rabbit (11)
- Gorilla (10)
- Hamster (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (7)
- Canis (5)
- Xenopus (3)
- Guinea Pig (2)
- Primate (2)
- C. elegans (1)
- Chimpanzee (1)
- Cow (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Sheep (1)
- Tobacco hornworm (1)
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (204)
- Transmembrane (121)
- Secreted Protein (73)
- ES Cell Differentiation/IPS (70)
- Protein Kinase (61)
- GPCR (44)
- Adult stem cells (34)
- Cancer stem cells (28)
- Stem cell relevant signaling - Wnt Signaling pathway (28)
- Transcription Factors (28)
- Nuclear Hormone Receptor (11)
- Induced pluripotent stem cells (4)
Pathways
- Wnt signaling pathway (204)
- Pathways in cancer (173)
- Basal cell carcinoma (146)
- Melanogenesis (143)
- Colorectal cancer (100)
- Hedgehog signaling pathway (73)
- Focal adhesion (47)
- Progesterone-mediated oocyte maturation (43)
- ErbB signaling pathway (30)
- Fc epsilon RI signaling pathway (30)
- GnRH signaling pathway (30)
- MAPK signaling pathway (30)
- Toll-like receptor signaling pathway (30)
- Epithelial cell signaling in Helicobacter pylori infection (29)
- Neurotrophin signaling pathway (28)
- Adipocytokine signaling pathway (27)
- Insulin signaling pathway (27)
- NOD-like receptor signaling pathway (27)
- Pancreatic cancer (27)
- RIG-I-like receptor signaling pathway (27)
- Type II diabetes mellitus (27)
- Regulation of actin cytoskeleton (23)
- Axon guidance (20)
- Chemokine signaling pathway (20)
- Leukocyte transendothelial migration (20)
- Pathogenic Escherichia coli infection (20)
- TGF-beta signaling pathway (20)
- Vascular smooth muscle contraction (20)
- Cell cycle (16)
- Oocyte meiosis (16)
- Ubiquitin mediated proteolysis (16)
- Endometrial cancer (13)
- Acute myeloid leukemia (10)
- Adherens junction (10)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (10)
- Prostate cancer (10)
- Thyroid cancer (10)
- Notch signaling pathway (8)
- T cell receptor signaling pathway (5)