Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Research Areas
View as table Download
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
LRP5 + LRP6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acid 437 of Human LRP. |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD41 (ITGA2B) (alpha) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from N-terminal domain of CD41 |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
NCAM1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NCAM1 |
TA371291 is a possible alternative to TA351057.
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
PD1 (PDCD1) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to 16 Amino Acid from near the carboxy terminus of Human PDCD1. |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Filter by
Category
Target Symbol
- MAPK8 (29)
- ESR1 (16)
- ROCK2 (16)
- IL6 (14)
- KIT (14)
- RORA (13)
- PECAM1 (11)
- CEBPD (10)
- CASP1 (9)
- CEBPB (9)
- TLR2 (9)
- ANAPC5 (8)
- IL6ST (8)
- ITGB3 (8)
- TCF25 (8)
- CD19 (7)
- ESR2 (7)
- FZD4 (7)
- IL1B (7)
- IL1RN (7)
- LEF1 (7)
- LRP6 (7)
- MME (7)
- ROCK1 (7)
- TCF4 (7)
- TCF7L2 (7)
- TLR4 (7)
- WNT1 (7)
- CD274 (6)
- CD8A (6)
- DVL2 (6)
- TLR3 (6)
- TNF (6)
- WNT2B (6)
- WNT3A (6)
- CD14 (5)
- FZD1 (5)
- FZD9 (5)
- IL18R1 (5)
- IL3RA (5)
- LGALS3 (5)
- MAPK9 (5)
- NCAM1 (5)
- TSLP (5)
- WNT16 (5)
- WNT5B (5)
- ANAPC10 (4)
- CD3E (4)
- CD4 (4)
- ENTPD6 (4)
- FZD10 (4)
- FZD2 (4)
- FZD6 (4)
- HLA-A (4)
- HLA-DMB (4)
- HLA-DPB1 (4)
- IL10 (4)
- IL2RA (4)
- IL4 (4)
- ITGA2B (4)
- LRP5 (4)
- MAPK10 (4)
- MS4A1 (4)
- ROR2 (4)
- TCF21 (4)
- WNT5A (4)
- WNT6 (4)
- WNT9A (4)
- ANAPC13 (3)
- APC2 (3)
- CALR (3)
- CD34 (3)
- CD68 (3)
- CD74 (3)
- CRP (3)
- CSRP3 (3)
- CXCL8 (3)
- DVL3 (3)
- FZD3 (3)
- FZD5 (3)
- FZD8 (3)
- GZMH (3)
- HLA-B (3)
- IL18 (3)
- IL1R1 (3)
- IL1RL1 (3)
- IL1RL2 (3)
- IL2 (3)
- IL36RN (3)
- PTK7 (3)
- PTPRC (3)
- ROR1 (3)
- TLR1 (3)
- WNT10A (3)
- WNT2 (3)
- WNT4 (3)
- ACE2 (2)
- AGBL2 (2)
- ANAPC11 (2)
- ANAPC2 (2)
Reactivities
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (29)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (365)
- Transmembrane (206)
- ES Cell Differentiation/IPS (113)
- Secreted Protein (104)
- Protein Kinase (66)
- Transcription Factors (63)
- Adult stem cells (41)
- Nuclear Hormone Receptor (29)
- GPCR (26)
- Stem cell relevant signaling - Wnt Signaling pathway (20)
- Cancer stem cells (19)
- Protease (18)
- Embryonic stem cells (14)
- Stem cell - Pluripotency (12)
- Induced pluripotent stem cells (8)
- Phosphatase (3)
Pathways
- Wnt signaling pathway (138)
- Pathways in cancer (131)
- Melanogenesis (94)
- Basal cell carcinoma (86)
- Colorectal cancer (74)
- Toll-like receptor signaling pathway (70)
- Hematopoietic cell lineage (67)
- Cytokine-cytokine receptor interaction (59)
- Focal adhesion (51)
- NOD-like receptor signaling pathway (45)
- MAPK signaling pathway (44)
- Hedgehog signaling pathway (40)
- Progesterone-mediated oocyte maturation (38)
- Fc epsilon RI signaling pathway (35)
- RIG-I-like receptor signaling pathway (33)
- Adipocytokine signaling pathway (31)
- Cell adhesion molecules (CAMs) (31)
- Epithelial cell signaling in Helicobacter pylori infection (31)
- Neurotrophin signaling pathway (31)
- Regulation of actin cytoskeleton (31)
- ErbB signaling pathway (29)
- GnRH signaling pathway (29)
- Type II diabetes mellitus (29)
- T cell receptor signaling pathway (28)
- Jak-STAT signaling pathway (27)
- Pancreatic cancer (27)
- Insulin signaling pathway (26)
- Pathogenic Escherichia coli infection (26)
- Leukocyte transendothelial migration (25)
- Allograft rejection (20)
- Chemokine signaling pathway (20)
- Graft-versus-host disease (20)
- TGF-beta signaling pathway (20)
- Axon guidance (19)
- Acute myeloid leukemia (18)
- Type I diabetes mellitus (18)
- Antigen processing and presentation (17)
- Vascular smooth muscle contraction (17)
- Autoimmune thyroid disease (16)
- Endocytosis (16)
- Primary immunodeficiency (16)
- Asthma (15)
- Cytosolic DNA-sensing pathway (15)
- Apoptosis (14)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (14)
- Alzheimer's disease (13)
- Amyotrophic lateral sclerosis (ALS) (12)
- Cell cycle (12)
- Hypertrophic cardiomyopathy (HCM) (12)
- Oocyte meiosis (12)
- Systemic lupus erythematosus (12)
- Ubiquitin mediated proteolysis (12)
- B cell receptor signaling pathway (11)
- Endometrial cancer (11)
- Renin-angiotensin system (10)
- Viral myocarditis (10)
- Adherens junction (9)
- Dilated cardiomyopathy (9)
- Prion diseases (8)
- Prostate cancer (8)
- Thyroid cancer (8)
- Natural killer cell mediated cytotoxicity (7)
- ECM-receptor interaction (6)
- Notch signaling pathway (6)
- Fc gamma R-mediated phagocytosis (4)
- Complement and coagulation cascades (3)
- Metabolic pathways (3)
- PPAR signaling pathway (3)
- Bladder cancer (2)
- Glutathione metabolism (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- VEGF signaling pathway (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Long-term depression (1)
- Parkinson's disease (1)