Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
USD 515.00
In Stock
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Active filters
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Category
Target Symbol
- KIT (13)
- WNT1 (9)
- CD19 (7)
- CD274 (7)
- MME (7)
- PECAM1 (7)
- TLR4 (7)
- FZD2 (6)
- FZD4 (6)
- FZD9 (6)
- IL2RA (6)
- IL6ST (6)
- TLR2 (6)
- TLR3 (6)
- TNF (6)
- WNT10A (6)
- WNT4 (6)
- WNT6 (6)
- WNT9A (6)
- CD8A (5)
- FZD1 (5)
- FZD10 (5)
- FZD8 (5)
- IL18R1 (5)
- ITGAX (5)
- ITGB3 (5)
- LRP5 (5)
- TLR8 (5)
- WNT16 (5)
- FZD3 (4)
- FZD5 (4)
- FZD6 (4)
- IL1R1 (4)
- LRP6 (4)
- PTPRC (4)
- ROR1 (4)
- TLR5 (4)
- TLR6 (4)
- TLR7 (4)
- ANPEP (3)
- CD14 (3)
- CR2 (3)
- IL1RL1 (3)
- IL3RA (3)
- PDCD1 (3)
- ROR2 (3)
- TLR1 (3)
- TNFRSF8 (3)
- WNT11 (3)
- ACE2 (2)
- CD34 (2)
- CD4 (2)
- CD46 (2)
- CXCL8 (2)
- ENTPD6 (2)
- HLA-DMB (2)
- IL1R2 (2)
- ITGA2B (2)
- NCAM1 (2)
- PTK7 (2)
- TNFRSF1B (2)
- WNT7A (2)
- BDNF (1)
- CD1A (1)
- CD207 (1)
- CD22 (1)
- CD33 (1)
- CD3E (1)
- CD5 (1)
- CD68 (1)
- CD74 (1)
- CD99 (1)
- FCER2 (1)
- FCGR3A (1)
- FUT4 (1)
- FZD7 (1)
- HFE (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-DRB5 (1)
- HLA-F (1)
- HLA-G (1)
- IL12B (1)
- IL1RAP (1)
- IL1RL2 (1)
- IL6R (1)
- ITGAE (1)
- MS4A1 (1)
- RYK (1)
- TLR10 (1)
- TLR9 (1)
- TMED1 (1)
- WNT7B (1)
Reactivities
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (107)
- Melanogenesis (103)
- Wnt signaling pathway (99)
- Basal cell carcinoma (90)
- Hematopoietic cell lineage (82)
- Cytokine-cytokine receptor interaction (55)
- Toll-like receptor signaling pathway (52)
- Colorectal cancer (46)
- Hedgehog signaling pathway (44)
- Cell adhesion molecules (CAMs) (43)
- Endocytosis (22)
- T cell receptor signaling pathway (21)
- Primary immunodeficiency (19)
- Antigen processing and presentation (17)
- Jak-STAT signaling pathway (17)
- Allograft rejection (16)
- MAPK signaling pathway (16)
- Regulation of actin cytoskeleton (16)
- Type I diabetes mellitus (16)
- Graft-versus-host disease (15)
- Apoptosis (14)
- Pathogenic Escherichia coli infection (14)
- Acute myeloid leukemia (13)
- Alzheimer's disease (13)
- Dilated cardiomyopathy (13)
- Hypertrophic cardiomyopathy (HCM) (13)
- Systemic lupus erythematosus (13)
- Asthma (12)
- Renin-angiotensin system (12)
- B cell receptor signaling pathway (11)
- Autoimmune thyroid disease (9)
- Natural killer cell mediated cytotoxicity (9)
- RIG-I-like receptor signaling pathway (9)
- Viral myocarditis (9)
- Adipocytokine signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Leukocyte transendothelial migration (8)
- NOD-like receptor signaling pathway (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- ECM-receptor interaction (7)
- Focal adhesion (7)
- Fc epsilon RI signaling pathway (6)
- TGF-beta signaling pathway (6)
- Type II diabetes mellitus (6)
- Complement and coagulation cascades (5)
- Fc gamma R-mediated phagocytosis (5)
- Metabolic pathways (4)
- Glutathione metabolism (3)
- Bladder cancer (2)
- Chemokine signaling pathway (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Prion diseases (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Small cell lung cancer (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Lysosome (1)
- Neurotrophin signaling pathway (1)