Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
USD 440.00
2 Weeks
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Anti-ROR1 Goat Polyclonal () Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
Rabbit Anti-Human TLR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
Rabbit Polyclonal TLR3 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A mix of synthetic peptides corresponding to amino acids 135-150 (SIHKIKSNPFKNQKNL), 828-844 (CRRFKVHHAVQQAIEQN), and 876-891 (CILNWPVQKERINAFH) of mouse TLR3. |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
USD 490.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 310F7.02/HD26
| Applications | ELISA, FC, IHC |
| Reactivities | Human, Mouse, Porcine, Rat |
| Conjugation | Biotin |
Rabbit Polyclonal ST2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ST2 antibody was raised against a synthetic peptide corresponding to 16 amino acids at the amino-terminus of mouse ST2. This peptide is common to all three known ST2 isoforms. |
Rabbit Polyclonal TLR3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR3. The immunogen is located within amino acids 780 - 830 of TLR3. |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal antibody to NULP1 (transcription factor 25 (basic helix-loop-helix))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 427 and 676 of NULP1 (Uniprot ID#Q9BQ70) |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit polyclonal FZD1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1. |
Rabbit polyclonal IL4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit Polyclonal TLR1 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a KLH-conjugated synthetic peptide corresponding to a sequence within amino acids 400-450 of human TLR1. |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Active filters
Reactivities
- Mouse
Applications
- IHC
Filter by
Category
Target Symbol
- LGALS3 (74)
- NCAM1 (58)
- ESR1 (44)
- TYRO3 (30)
- MAPK9 (28)
- ANAPC11 (26)
- MME (25)
- ROR2 (25)
- WNT3 (21)
- DVL2 (17)
- MAPK8 (16)
- PDCD1 (14)
- ITGB3 (13)
- POSTN (10)
- LEF1 (8)
- TLR2 (8)
- TLR4 (8)
- TNF (8)
- ANAPC2 (7)
- CASP1 (6)
- MS4A1 (6)
- PECAM1 (6)
- AGTPBP1 (5)
- CD2 (5)
- CD22 (5)
- CEBPB (5)
- PTK7 (5)
- TLR3 (5)
- ANAPC5 (4)
- CD68 (4)
- CD74 (4)
- ESR2 (4)
- IL1B (4)
- KIT (4)
- ROCK1 (4)
- ROCK2 (4)
- ROR1 (4)
- TLR5 (4)
- WNT1 (4)
- WNT10A (4)
- WNT11 (4)
- AGBL2 (3)
- ANAPC10 (3)
- CCP110 (3)
- CD274 (3)
- CD34 (3)
- CD5 (3)
- CSRP3 (3)
- DVL3 (3)
- FZD1 (3)
- FZD3 (3)
- FZD4 (3)
- FZD8 (3)
- IL1RL1 (3)
- IL6ST (3)
- LRP5 (3)
- PTPRC (3)
- TCF25 (3)
- TLR1 (3)
- TLR7 (3)
- TLR9 (3)
- TOLLIP (3)
- WNT2 (3)
- WNT2B (3)
- WNT3A (3)
- AGBL3 (2)
- ANAPC15 (2)
- ANPEP (2)
- CD33 (2)
- CR2 (2)
- CRP (2)
- CSF3 (2)
- CSRP2 (2)
- ENTPD6 (2)
- FZD6 (2)
- HLA-DPB1 (2)
- IL12B (2)
- IL18 (2)
- IL18R1 (2)
- IL1R1 (2)
- IL1RAP (2)
- IL1RAPL2 (2)
- IL1RN (2)
- IL36RN (2)
- IL3RA (2)
- ITGAX (2)
- LRP6 (2)
- TLR6 (2)
- TLR8 (2)
- TMED1 (2)
- TSLP (2)
- WNT4 (2)
- WNT5A (2)
- WNT5B (2)
- WNT6 (2)
- AGBL1 (1)
- AGBL5 (1)
- ANAPC13 (1)
- ARAF (1)
- BDNF (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (54)
- Phospho-specific (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (488)
- Transmembrane (269)
- ES Cell Differentiation/IPS (156)
- Secreted Protein (145)
- Protein Kinase (117)
- Transcription Factors (61)
- Nuclear Hormone Receptor (45)
- Protease (35)
- Adult stem cells (19)
- Cancer stem cells (10)
- GPCR (10)
- Stem cell relevant signaling - Wnt Signaling pathway (10)
- Induced pluripotent stem cells (4)
- Embryonic stem cells (2)
- Phosphatase (2)
- Stem cell - Pluripotency (1)
Pathways
- Wnt signaling pathway (135)
- Pathways in cancer (132)
- Cell adhesion molecules (CAMs) (87)
- Melanogenesis (84)
- Basal cell carcinoma (82)
- Progesterone-mediated oocyte maturation (81)
- Colorectal cancer (80)
- Toll-like receptor signaling pathway (80)
- Hematopoietic cell lineage (70)
- Focal adhesion (64)
- Prion diseases (58)
- MAPK signaling pathway (55)
- T cell receptor signaling pathway (52)
- NOD-like receptor signaling pathway (50)
- ErbB signaling pathway (49)
- Fc epsilon RI signaling pathway (49)
- Adipocytokine signaling pathway (48)
- Insulin signaling pathway (47)
- Neurotrophin signaling pathway (47)
- Type II diabetes mellitus (47)
- Hedgehog signaling pathway (46)
- Pancreatic cancer (45)
- RIG-I-like receptor signaling pathway (45)
- GnRH signaling pathway (43)
- Epithelial cell signaling in Helicobacter pylori infection (42)
- Cell cycle (37)
- Oocyte meiosis (37)
- Ubiquitin mediated proteolysis (37)
- Alzheimer's disease (30)
- Regulation of actin cytoskeleton (27)
- Renin-angiotensin system (27)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (19)
- Cytokine-cytokine receptor interaction (18)
- Notch signaling pathway (17)
- Dilated cardiomyopathy (16)
- Hypertrophic cardiomyopathy (HCM) (16)
- Pathogenic Escherichia coli infection (16)
- Acute myeloid leukemia (12)
- ECM-receptor interaction (12)
- Leukocyte transendothelial migration (12)
- Apoptosis (11)
- Chemokine signaling pathway (11)
- Endometrial cancer (10)
- Prostate cancer (10)
- Vascular smooth muscle contraction (10)
- Axon guidance (9)
- B cell receptor signaling pathway (9)
- Natural killer cell mediated cytotoxicity (9)
- TGF-beta signaling pathway (9)
- Thyroid cancer (8)
- Adherens junction (7)
- Jak-STAT signaling pathway (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Cytosolic DNA-sensing pathway (6)
- Chronic myeloid leukemia (5)
- Glioma (5)
- Graft-versus-host disease (5)
- Renal cell carcinoma (5)
- Type I diabetes mellitus (5)
- Allograft rejection (4)
- Asthma (4)
- Fc gamma R-mediated phagocytosis (4)
- Melanoma (4)
- Non-small cell lung cancer (4)
- Small cell lung cancer (4)
- VEGF signaling pathway (4)
- Bladder cancer (3)
- Endocytosis (3)
- Long-term depression (3)
- Long-term potentiation (3)
- Primary immunodeficiency (3)
- Systemic lupus erythematosus (3)
- mTOR signaling pathway (3)
- Glutathione metabolism (2)
- Metabolic pathways (2)
- Tight junction (2)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Complement and coagulation cascades (1)
- Gap junction (1)
- Huntington's disease (1)
- Inositol phosphate metabolism (1)
- Lysosome (1)
- Phosphatidylinositol signaling system (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)