Germany
Japan
United Kingdom
China
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Research Areas
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
Rabbit Polyclonal JNK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3. |
Rabbit polyclonal anti-MAPK10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK2 |
Rabbit polyclonal ROCK2 (Ab-722) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S). |
Mouse Monoclonal ITGB3 (CD61) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD41 (ITGA2B) mouse monoclonal antibody, clone 96.2C1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
ROCK2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human ROCK2 |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3. |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK |
JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Active filters
Category
-
- Antibodies
-
Pathways
- Focal adhesion