Products

View as table Download

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-MAOA Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOA

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit anti-HADH Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADH

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Mouse monoclonal ALDH2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal KMO Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KMO antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 155-182 amino acids from the Central region of human KMO.

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Rabbit Polyclonal Anti-ABP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

INDOL1 (IDO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 267-295 amino acids from the C-terminal region of Human IDO2 / INDOL1

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)

HADHSC (HADH) mouse monoclonal antibody, clone 4B5, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human

Rabbit polyclonal CYP1A2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2.

ALDH2 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit Polyclonal HAAO Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HAAO antibody was raised against a 17 amino acid peptide near the amino terminus of human HAAO.

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit polyclonal anti-EHHADH antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EHHADH.

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human

Tryptophan Hydroxylase (TPH1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1.

Tryptophan Hydroxylase (TPH1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Catalase (CAT) (498-511) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Mouse
Immunogen Synthetic peptide from an internal region of human CAT

HAAO (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ACAT1.
Epitope: Internal.

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)

Rabbit polyclonal Cytochrome P450 1A2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2.

KATII / AADAT Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from N-terminus of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Elephant (100%); Monkey, Rabbit (94%); Marmoset, Dog (82%).

KATII / AADAT Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (88%); Dog, Elephant (82%).

Rabbit polyclonal HADHA Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA.

Rabbit polyclonal TPH2 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2.

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP

Catalase (CAT) (159-188) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 159~188 amino acids from the Center region of Human CAT

Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Catalase (CAT) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide

GCDH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 335-365 amino acids from the C-terminal region of Human GCD / GCDH

Rabbit Polyclonal antibody to ACMSD (aminocarboxymuconate semialdehyde decarboxylase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 105 and 336 of ACMSD (Uniprot ID#Q8TDX5)