Germany
Japan
United Kingdom
China
Rabbit anti-NRP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRP1 |
Products
Download
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
USD 440.00
2 Weeks
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal EPHA3 (Ab-602) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPHA3. |
Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165 |
| Modifications | Phospho-specific |
Goat Anti-UNC5B (aa629-643) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SARDWIFQLKTQAHQ, from the internal region of the protein sequence according to NP_734465.2. |
Rabbit anti-EFNA1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EFNA1 |
Rabbit Polyclonal Anti-EPHA5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5. Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP |
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA7 Antibody: A synthesized peptide derived from human EPHA7 |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal Anti-EPHA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3 |
USD 440.00
2 Weeks
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit monoclonal antibody against NFAT1 (clone EPR2973 )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal NFAT3 (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T). |
Rabbit polyclonal anti-EFNA3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EFNA3. |
Rabbit polyclonal c-Met (Ab-1003) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Cofilin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cofilin. |
Rabbit polyclonal anti-EPHA3 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA3. |
Rabbit polyclonal CRMP-2 (Ab-509) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CRMP-2 around the phosphorylation site of threonine 509 (S-V-TP-P-K). |
Active filters
Applications
- WB
Pathways
- Axon guidance
Filter by
Target Symbol
- L1CAM (94)
- MAPK1 (68)
- LIMK1 (62)
- MET (60)
- KRAS (58)
- EFNA2 (48)
- HRAS (45)
- PTK2 (35)
- CHP1 (28)
- SEMA4D (27)
- MAPK3 (22)
- PAK4 (22)
- RASA1 (21)
- SEMA3G (21)
- DPYSL2 (19)
- ABL1 (18)
- PAK1 (18)
- CDK5 (17)
- GSK3B (17)
- ITGB1 (17)
- NRAS (16)
- CFL1 (15)
- EPHA1 (14)
- EPHA2 (14)
- ROCK2 (14)
- CXCL12 (13)
- CXCR4 (13)
- PPP3CA (13)
- DCC (12)
- NFATC1 (12)
- EFNB2 (11)
- FYN (11)
- RND1 (11)
- GNAI1 (10)
- LIMK2 (10)
- NFATC4 (9)
- PPP3CB (9)
- RHOA (9)
- RHOD (8)
- PAK2 (7)
- SEMA3D (7)
- EFNB1 (6)
- EPHA3 (6)
- EPHA6 (6)
- EPHB1 (6)
- FES (6)
- NCK2 (6)
- NFATC2 (6)
- NRP1 (6)
- CDC42 (5)
- EFNA5 (5)
- EFNB3 (5)
- EPHA7 (5)
- NFATC3 (5)
- PAK3 (5)
- PAK5 (5)
- RAC1 (5)
- ROCK1 (5)
- CFL2 (4)
- EPHA4 (4)
- EPHB2 (4)
- EPHB4 (4)
- GNAI2 (4)
- NCK1 (4)
- RGS3 (4)
- UNC5C (4)
- EFNA1 (3)
- EFNA4 (3)
- EPHA5 (3)
- EPHB6 (3)
- NTN1 (3)
- PPP3CC (3)
- ROBO1 (3)
- SEMA4A (3)
- SEMA6D (3)
- SEMA7A (3)
- ABLIM1 (2)
- ARHGEF12 (2)
- DPYSL5 (2)
- EFNA3 (2)
- GNAI3 (2)
- NFAT5 (2)
- RAC2 (2)
- SEMA3B (2)
- SEMA4F (2)
- SEMA6A (2)
- SLIT2 (2)
- SRGAP1 (2)
- SRGAP2 (2)
- CHP2 (1)
- EPHB3 (1)
- LRRC4C (1)
- NTN3 (1)
- NTN4 (1)
- NTNG1 (1)
- PLXNA2 (1)
- PLXNB1 (1)
- PLXNB3 (1)
- PPP3R1 (1)
- PPP3R2 (1)