Rabbit polyclonal Hsp110 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat, Sheep, Yeast, Cow |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of hamster Hsp110; sequence identical to human and mouse |
Mouse monoclonal GRP94 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig, Horse |
| Conjugation | Unconjugated |
Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rat Monoclonal Anti-HSF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig, Hamster, Monkey, Rabbit. Dog, Bovine, Sheep, Pig |
| Conjugation | Unconjugated |
Rat Monoclonal Anti-TCP1 alpha Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse, Rabbit, Rat, Sheep, Dog, Cow |
| Conjugation | Unconjugated |
Mouse monoclonal anti-PCNA antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Anti-Kcnq3 Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Rabbit Polyclonal Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Rabbit Polyclonal Anti-ATIC Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
Mouse Monoclonal Beclin 1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
Mouse Monoclonal Beclin 1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
Mouse Monoclonal STAT3 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
p38 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
JNK Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
MMP12 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
Moesin Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
NDUFS6 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Thyroid Transcription Factor 1 Rabbit monoclonal Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
ALIX Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
PI3 Kinase p85 alpha Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
Phospho-Smad3 (Ser423/425) Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
TBK1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
