Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
NOS1 (1419-1433) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal ABCA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Rabbit polyclonal DDIT3 Antibody (C-term A135)
| Applications | FC, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DDIT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the C-terminal region of human DDIT3. |
Rabbit polyclonal Vimentin Antibody (S82)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from human Vimentin. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Antibody against DRP1
| Applications | IHC |
| Reactivities | Human, Primate, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal COPE Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This COPE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-300 amino acids from the C-terminal region of human COPE. |
Rabbit polyclonal PCYT1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit polyclonal TSN Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TSN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human TSN. |
Rabbit polyclonal Vimentin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Vimentin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-457 amino acids from the C-terminal region of human Vimentin. |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Mouse Monoclonal beta Actin Antibody
| Applications | WB |
| Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-HSPA5 Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
| Conjugation | Unconjugated |
| Immunogen | Rat GRP78 (Bip) sythetic peptide (amino acids 645-654, C-terminus) conjugated to KLH. Identical to mouse and hamster GRP78 sequenes over residues EEDTSEKDEL. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Active filters
Reactivities
- Hamster
Applications
- WB
Filter by
Category
Target Symbol
- CANX (6)
- HSPD1 (6)
- HSPA1A (5)
- HSPA8 (4)
- ACTB (3)
- TUBB (3)
- VIM (3)
- BECLIN 1 (2)
- CALR (2)
- CCNB1 (2)
- HIF1A (2)
- HP1 GAMMA (2)
- HSP90B1 (2)
- HSPA5 (2)
- KCNQ1 (2)
- MAP2K1 (2)
- MAPK14 (2)
- PCNA (2)
- PDIA3 (2)
- SCARB1 (2)
- SMAD3 (2)
- SNAP25 (2)
- SREBF1 (2)
- STIP1 (2)
- SYNTAXIN (2)
- TCP1 (2)
- ABCA1 (1)
- ABCG1 (1)
- ACTA1 (1)
- AGR2 (1)
- AKT1 (1)
- AKT2 (1)
- ALDH2 (1)
- ATIC (1)
- BCL2L1 (1)
- CD8A (1)
- CDK2 (1)
- COPE (1)
- COX4I1 (1)
- CTNNB1 (1)
- DDIT3 (1)
- DNM1L (1)
- FASN (1)
- FAU (1)
- FEN1 (1)
- FKBP4 (1)
- FKBP5 (1)
- FTH1 (1)
- GAPDH (1)
- GSK3B (1)
- HK2 (1)
- HMGA1 (1)
- HMGB1 (1)
- HSF2 (1)
- HSPH1 (1)
- INSIG1 (1)
- KCNQ2 (1)
- KCNQ3 (1)
- KCNQ4 (1)
- KDELR1 (1)
- KDM1A (1)
- KDR (1)
- KIF11 (1)
- KRT10 (1)
- LAMP1 (1)
- LPP (1)
- MAPK8 (1)
- MMP12 (1)
- MSN (1)
- NDUFS6 (1)
- NKX2-1 (1)
- NPC1 (1)
- OPA1 (1)
- PCYT1A (1)
- PDCD6IP (1)
- PIK3R1 (1)
- PMS2 (1)
- PPARA (1)
- PPP3CB (1)
- PRDX2 (1)
- PRION (1)
- RAD21 (1)
- RAD23B (1)
- RAD50 (1)
- RBBP4 (1)
- RPS20 (1)
- SAT1 (1)
- SCARB2 (1)
- SCD (1)
- SF3B1 (1)
- SMAD2 (1)
- SOD1 (1)
- SOD2 (1)
- SORBS1 (1)
- SPP1 (1)
- SRC (1)
- STAT3 (1)
- STX1A (1)
- SUMO2 (1)
- TAF7 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho-specific (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
Pathways
- Antigen processing and presentation (20)
- MAPK signaling pathway (15)
- Prion diseases (12)
- Pathways in cancer (11)
- Endocytosis (10)
- Focal adhesion (8)
- Spliceosome (8)
- Insulin signaling pathway (7)
- Metabolic pathways (7)
- Pancreatic cancer (7)
- VEGF signaling pathway (7)
- Pathogenic Escherichia coli infection (6)
- Prostate cancer (6)
- RNA degradation (6)
- Renal cell carcinoma (6)
- Type I diabetes mellitus (6)
- Vibrio cholerae infection (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Chronic myeloid leukemia (5)
- Gap junction (5)
- Neurotrophin signaling pathway (5)
- Progesterone-mediated oocyte maturation (5)
- Regulation of actin cytoskeleton (5)
- T cell receptor signaling pathway (5)
- Acute myeloid leukemia (4)
- Adherens junction (4)
- Apoptosis (4)
- B cell receptor signaling pathway (4)
- Base excision repair (4)
- Bladder cancer (4)
- Cell cycle (4)
- Chemokine signaling pathway (4)
- Colorectal cancer (4)
- Endometrial cancer (4)
- Fc epsilon RI signaling pathway (4)
- Fc gamma R-mediated phagocytosis (4)
- Glioma (4)
- Leukocyte transendothelial migration (4)
- Melanoma (4)
- Non-small cell lung cancer (4)
- Oocyte meiosis (4)
- Tight junction (4)
- Toll-like receptor signaling pathway (4)
- mTOR signaling pathway (4)
- Alzheimer's disease (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- DNA replication (3)
- Dilated cardiomyopathy (3)
- ErbB signaling pathway (3)
- GnRH signaling pathway (3)
- Huntington's disease (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Jak-STAT signaling pathway (3)
- Long-term potentiation (3)
- Mismatch repair (3)
- NOD-like receptor signaling pathway (3)
- Natural killer cell mediated cytotoxicity (3)
- Non-homologous end-joining (3)
- Nucleotide excision repair (3)
- Small cell lung cancer (3)
- Thyroid cancer (3)
- Viral myocarditis (3)
- ABC transporters (2)
- Adipocytokine signaling pathway (2)
- Arginine and proline metabolism (2)
- Cytokine-cytokine receptor interaction (2)
- Dorso-ventral axis formation (2)
- Glycolysis / Gluconeogenesis (2)
- Long-term depression (2)
- Lysosome (2)
- Melanogenesis (2)
- PPAR signaling pathway (2)
- Parkinson's disease (2)
- Regulation of autophagy (2)
- SNARE interactions in vesicular transport (2)
- Vascular smooth muscle contraction (2)
- Wnt signaling pathway (2)
- p53 signaling pathway (2)
- Ascorbate and aldarate metabolism (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Butanoate metabolism (1)
- Calcium signaling pathway (1)
- Cardiac muscle contraction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fatty acid biosynthesis (1)
- Fatty acid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Histidine metabolism (1)
- Homologous recombination (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Propanoate metabolism (1)
- Purine metabolism (1)
- Pyruvate metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Ribosome (1)
- Tryptophan metabolism (1)
- Valine (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine degradation (1)