Germany
Japan
United Kingdom
China
Products
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight633 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 633 |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 550 conjugated
| Reactivities | Human, Mouse |
| Conjugation | DyLight 550 |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Adenosine Receptor A2a (ADORA2A) (full length) Mouse Monoclonal Antibody [Clone ID: 7F6-G5-A2 / 7F6]
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Anti-LGR5 mouse mAb, clone OTI2A2, HRP conjugated
| Reactivities | Human, Mouse |
| Conjugation | HRP |
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Rat |
| Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4 |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit polyclonal anti-SPR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
Active filters
Category
-
- Antibodies
-
Families
- GPCR
Filter by
Target Symbol
- LGR5 (84)
- GPR17 (39)
- CXCR4 (23)
- GPR83 (19)
- F2R (14)
- ADRA1B (13)
- LGR4 (13)
- SSTR3 (13)
- ADRB2 (12)
- CASR (12)
- CCR5 (11)
- CCR7 (11)
- CRHR1 (11)
- GPR26 (11)
- HCRTR1 (11)
- HTR4 (11)
- NTSR1 (11)
- CX3CR1 (10)
- FPR1 (10)
- GABBR1 (10)
- GRM4 (10)
- GRM7 (10)
- HTR7 (10)
- PTGER3 (10)
- SSTR1 (10)
- C5AR1 (9)
- CXCR2 (9)
- CXCR3 (9)
- FPR2 (9)
- GRM3 (9)
- HTR5A (9)
- LPAR1 (9)
- LPAR4 (9)
- NPY1R (9)
- S1PR1 (9)
- SSTR2 (9)
- SSTR4 (9)
- SSTR5 (9)
- TSHR (9)
- ADORA2A (8)
- ADRA2A (8)
- APLNR (8)
- CCR2 (8)
- CCR8 (8)
- CHRM1 (8)
- CNR2 (8)
- FZD2 (8)
- FZD4 (8)
- GHRHR (8)
- GRM1 (8)
- GRM2 (8)
- HTR1F (8)
- HTR2C (8)
- P2RY2 (8)
- ADRA2C (7)
- AVPR1B (7)
- BDKRB1 (7)
- CCR3 (7)
- CCR4 (7)
- CYSLTR1 (7)
- DRD1 (7)
- GIPR (7)
- GPR3 (7)
- GPR75 (7)
- GRM5 (7)
- GRM8 (7)
- HTR1A (7)
- KISS1R (7)
- NPY2R (7)
- OPN3 (7)
- OPRM1 (7)
- OR51E1 (7)
- PTGER2 (7)
- RXFP1 (7)
- S1PR3 (7)
- ADGRE5 (6)
- ADRA1A (6)
- ADRB3 (6)
- AGTR1 (6)
- AVPR1A (6)
- BRS3 (6)
- CYSLTR2 (6)
- FFAR1 (6)
- FSHR (6)
- FZD9 (6)
- GHSR (6)
- GLP2R (6)
- GNRHR (6)
- GPR173 (6)
- GPR50 (6)
- GRPR (6)
- HRH1 (6)
- HRH2 (6)
- HRH4 (6)
- HTR1E (6)
- LPAR3 (6)
- LTB4R2 (6)
- MAS1 (6)
- MC1R (6)
- MC2R (6)
Reactivities
- Human (1304)
- Mouse (682)
- Rat (618)
- Monkey (109)
- Dog (75)
- Bovine (59)
- Gorilla (56)
- Rabbit (47)
- Pig (45)
- Bat (39)
- Horse (37)
- Hamster (35)
- Gibbon (34)
- Chimpanzee (15)
- Cow (15)
- Chicken (10)
- Xenopus (10)
- Primate (9)
- Guinea Pig (8)
- Rhesus Monkey (6)
- Orang-Utan (5)
- Zebrafish (5)
- Canine (3)
- Sheep (3)
- Macaque (2)
- X. tropicalis (2)
- Equine (1)
- Feline (1)
- Goat (1)
- Murine (1)
- Porcine (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (939)
- Calcium signaling pathway (288)
- Chemokine signaling pathway (123)
- Cytokine-cytokine receptor interaction (123)
- Endocytosis (85)
- Vascular smooth muscle contraction (66)
- Melanogenesis (55)
- Gap junction (52)
- Basal cell carcinoma (44)
- Colorectal cancer (44)
- Pathways in cancer (44)
- Regulation of actin cytoskeleton (44)
- Wnt signaling pathway (44)
- Complement and coagulation cascades (37)
- Long-term depression (26)
- Axon guidance (23)
- Leukocyte transendothelial migration (23)
- Olfactory transduction (21)
- Renin-angiotensin system (16)
- Long-term potentiation (15)
- Epithelial cell signaling in Helicobacter pylori infection (14)
- Taste transduction (10)
- Autoimmune thyroid disease (9)
- Huntington's disease (7)
- GnRH signaling pathway (6)
- Dilated cardiomyopathy (5)
- Parkinson's disease (5)