Germany
Japan
United Kingdom
China
Products
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Goat Polyclonal Anti-AIFM1 (aa183-195) Antibody
| Applications | IF, WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AIFM1 (aa183-195) Antibody: Peptide with sequence C-DDPNVTKTLRFKQ, from the internal region of the protein sequence according to NP_004199.1; NP_665811.1; NP_001124319.1. |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Active filters
Category
-
- Antibodies
-
Pathways
- Melanoma
Filter by
Target Symbol
- TP53 (255)
- MAP2K1 (237)
- EGFR (207)
- CDKN2A (198)
- AKT1 (127)
- MDM2 (121)
- BRAF (100)
- FGF21 (75)
- MAPK1 (74)
- CDH1 (71)
- MET (64)
- PIK3CG (64)
- PDGFRA (63)
- RB1 (59)
- KRAS (58)
- PDGFRB (50)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- FGFR1 (43)
- EGF (38)
- CCND1 (37)
- CDKN1A (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- FGF2 (31)
- HGF (31)
- IGF1 (31)
- IGF1R (29)
- PIK3CA (25)
- ARAF (24)
- MAPK3 (23)
- PTEN (23)
- BAD (21)
- AKT3 (19)
- MITF (19)
- NRAS (17)
- PDGFB (16)
- PIK3R1 (14)
- FGF1 (13)
- FGF13 (13)
- FGF4 (13)
- E2F1 (12)
- PDGFA (11)
- CDK6 (10)
- CDK4 (9)
- E2F2 (9)
- FGF7 (6)
- PDGFD (6)
- FGF18 (5)
- FGF23 (5)
- FGF8 (5)
- PDGFC (5)
- FGF10 (4)
- FGF12 (4)
- FGF16 (4)
- PIK3CB (4)
- PIK3R3 (4)
- E2F3 (3)
- FGF20 (3)
- FGF22 (3)
- B RAF (2)
- FGF11 (2)
- FGF14 (2)
- FGF17 (2)
- FGF19 (2)
- FGF3 (2)
- PIK3R2 (2)
- FGF5 (1)
- FGF6 (1)
- FGF9 (1)
Reactivities
- Human (2436)
- Mouse (1615)
- Rat (1523)
- Monkey (412)
- Dog (342)
- Chicken (13)
- Pig (13)
- Bovine (11)
- Cow (8)
- Xenopus (8)
- Canine (6)
- Rabbit (6)
- Hamster (4)
- Drosophila (3)
- Canis (2)
- Chimpanzee (2)
- Primate (2)
- Zebrafish (2)
- Feline (1)
- Guinea Pig (1)
- Horse (1)
- Rhesus Monkey (1)
- Sheep (1)
- X. tropicalis (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2595)
- Protein Kinase (1192)
- ES Cell Differentiation/IPS (878)
- Transmembrane (616)
- Transcription Factors (482)
- Secreted Protein (441)
- Adult stem cells (381)
- Stem cell - Pluripotency (292)
- Stem cell relevant signaling - JAK/STAT signaling pathway (244)
- Cancer stem cells (207)
- Embryonic stem cells (143)
- Induced pluripotent stem cells (56)
- Stem cell relevant signaling - Wnt Signaling pathway (50)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Protease (31)
- Phosphatase (23)