Germany
Japan
United Kingdom
China
Products
Download
Anti-SAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
USD 524.00
In Stock
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-DDAH2 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDAH2 antibody: synthetic peptide directed towards the N terminal of human DDAH2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG |
Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
Chicken polyclonal anti-TUBA1A(alpha Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Active filters
Reactivities
- Mouse
Citations
- Yes
Filter by
Target Symbol
- GAPDH (15)
- LGR5 (8)
- ACTB (7)
- VIM (7)
- CANX (6)
- CDH2 (6)
- GBE1 (6)
- MAPK8 (6)
- SNAI1 (6)
- ALK (5)
- BECN1 (5)
- CTNNB1 (5)
- HSPA1A (5)
- KRT8 (5)
- LOXL2 (5)
- MME (5)
- MMP2 (5)
- NCAM1 (5)
- SOX17 (5)
- ZEB1 (5)
- ALDH1A3 (4)
- ARNTL (4)
- BAX (4)
- CDX2 (4)
- DPP9 (4)
- GATA4 (4)
- KEAP1 (4)
- LTA4H (4)
- MAPK1 (4)
- NIT2 (4)
- NR4A3 (4)
- PDE10A (4)
- POSTN (4)
- PRRX1 (4)
- SAMHD1 (4)
- SLC7A8 (4)
- SNAI2 (4)
- SQSTM1 (4)
- UNG (4)
- ABCG2 (3)
- ALDH1L1 (3)
- BCL2 (3)
- ERBB2 (3)
- ERCC1 (3)
- FGF2 (3)
- GBA (3)
- HIF1A (3)
- HNRNPM (3)
- HSP90AA1 (3)
- HSPD1 (3)
- IGF1R (3)
- JAK2 (3)
- KRT18 (3)
- LIMK1 (3)
- MAPK3 (3)
- NOTCH1 (3)
- NTRK2 (3)
- PARP1 (3)
- PECAM1 (3)
- PPARGC1A (3)
- PPP4C (3)
- PRKAR1A (3)
- RAC1 (3)
- RELA (3)
- SH2D2A (3)
- SLC18A2 (3)
- STAT3 (3)
- TGFBR2 (3)
- TMEM100 (3)
- TNNI3 (3)
- TP63 (3)
- TUBB (3)
- ZEB2 (3)
- ABCC4 (2)
- ABCD1 (2)
- ACAA2 (2)
- ACTA2 (2)
- ACTN1 (2)
- ADH5 (2)
- AFG3L2 (2)
- AKT1 (2)
- AKT3 (2)
- ALDH2 (2)
- ANXA1 (2)
- ANXA3 (2)
- AOX1 (2)
- APMAP (2)
- APPL1 (2)
- AQP1 (2)
- ARNT (2)
- B3GNT2 (2)
- BAG3 (2)
- BCAT1 (2)
- BCL2L1 (2)
- BDNF (2)
- BMP4 (2)
- BRAF (2)
- BTK (2)
- CAT (2)
- CCNA2 (2)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (750)
- Transmembrane (271)
- Transcription Factors (174)
- ES Cell Differentiation/IPS (139)
- Protein Kinase (100)
- Secreted Protein (85)
- Protease (58)
- Stem cell - Pluripotency (51)
- Adult stem cells (27)
- Embryonic stem cells (24)
- GPCR (24)
- Induced pluripotent stem cells (17)
- Cancer stem cells (14)
- Ion Channels: Other (10)
- Phosphatase (10)
- Nuclear Hormone Receptor (9)
- Stem cell relevant signaling - DSL/Notch pathway (9)
- Stem cell relevant signaling - JAK/STAT signaling pathway (9)
- P450 (8)
- Ion Channels: Transient receptor potential (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Ion Channels: Glutamate Receptors (3)
- Ion Channels: ATP Receptors (2)
- Ion Channels: Cys-loop Receptors (1)
Pathways
- Pathways in cancer (151)
- Metabolic pathways (130)
- Focal adhesion (92)
- MAPK signaling pathway (81)
- Colorectal cancer (63)
- Regulation of actin cytoskeleton (62)
- Neurotrophin signaling pathway (61)
- Prostate cancer (61)
- Pancreatic cancer (57)
- Adherens junction (56)
- Alzheimer's disease (46)
- Chemokine signaling pathway (46)
- Chronic myeloid leukemia (46)
- Renal cell carcinoma (45)
- Insulin signaling pathway (44)
- Progesterone-mediated oocyte maturation (44)
- ErbB signaling pathway (43)
- Toll-like receptor signaling pathway (41)
- Small cell lung cancer (40)
- Endocytosis (39)
- Leukocyte transendothelial migration (39)
- Melanoma (38)
- Endometrial cancer (37)
- Glioma (36)
- Wnt signaling pathway (36)
- Bladder cancer (35)
- Acute myeloid leukemia (34)
- Apoptosis (33)
- Axon guidance (33)
- VEGF signaling pathway (33)
- Adipocytokine signaling pathway (32)
- Glycolysis / Gluconeogenesis (32)
- T cell receptor signaling pathway (32)
- B cell receptor signaling pathway (31)
- Cell adhesion molecules (CAMs) (31)
- Fc epsilon RI signaling pathway (31)
- Pathogenic Escherichia coli infection (31)
- Huntington's disease (30)
- Natural killer cell mediated cytotoxicity (30)
- Non-small cell lung cancer (30)
- Prion diseases (30)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (29)
- Jak-STAT signaling pathway (29)
- NOD-like receptor signaling pathway (29)
- Tight junction (29)
- Gap junction (28)
- Fc gamma R-mediated phagocytosis (27)
- GnRH signaling pathway (27)
- Amyotrophic lateral sclerosis (ALS) (25)
- Thyroid cancer (25)
- Type II diabetes mellitus (25)
- Cell cycle (23)
- Epithelial cell signaling in Helicobacter pylori infection (23)
- RIG-I-like receptor signaling pathway (23)
- TGF-beta signaling pathway (23)
- Viral myocarditis (23)
- p53 signaling pathway (23)
- Antigen processing and presentation (22)
- Cytokine-cytokine receptor interaction (22)
- Dilated cardiomyopathy (22)
- Hypertrophic cardiomyopathy (HCM) (21)
- Melanogenesis (21)
- Purine metabolism (21)
- mTOR signaling pathway (20)
- ECM-receptor interaction (19)
- Vascular smooth muscle contraction (19)
- Dorso-ventral axis formation (18)
- Long-term depression (18)
- Calcium signaling pathway (17)
- Neuroactive ligand-receptor interaction (17)
- Oocyte meiosis (17)
- Ubiquitin mediated proteolysis (17)
- Hematopoietic cell lineage (16)
- Long-term potentiation (16)
- Lysosome (16)
- Basal cell carcinoma (15)
- Parkinson's disease (15)
- Drug metabolism - cytochrome P450 (14)
- Cytosolic DNA-sensing pathway (13)
- Vibrio cholerae infection (13)
- ABC transporters (12)
- Spliceosome (12)
- Starch and sucrose metabolism (12)
- Type I diabetes mellitus (12)
- Base excision repair (11)
- Citrate cycle (TCA cycle) (11)
- Arginine and proline metabolism (10)
- Metabolism of xenobiotics by cytochrome P450 (10)
- Tyrosine metabolism (10)
- Primary immunodeficiency (9)
- Pyrimidine metabolism (9)
- Retinol metabolism (9)
- Valine (9)
- leucine and isoleucine degradation (9)
- Alanine (8)
- Arachidonic acid metabolism (8)
- Histidine metabolism (8)
- Regulation of autophagy (8)
- Systemic lupus erythematosus (8)
- Tryptophan metabolism (8)
- aspartate and glutamate metabolism (8)
- Cardiac muscle contraction (7)
- Cysteine and methionine metabolism (7)
- Fructose and mannose metabolism (7)
- Nucleotide excision repair (7)
- Oxidative phosphorylation (7)
- Porphyrin and chlorophyll metabolism (7)
- Renin-angiotensin system (7)
- beta-Alanine metabolism (7)
- Fatty acid metabolism (6)
- Galactose metabolism (6)
- Hedgehog signaling pathway (6)
- RNA degradation (6)
- Sphingolipid metabolism (6)
- Allograft rejection (5)
- Butanoate metabolism (5)
- Glutathione metabolism (5)
- Graft-versus-host disease (5)
- Inositol phosphate metabolism (5)
- Maturity onset diabetes of the young (5)
- Notch signaling pathway (5)
- One carbon pool by folate (5)
- PPAR signaling pathway (5)
- Phosphatidylinositol signaling system (5)
- Propanoate metabolism (5)
- Proteasome (5)
- Pyruvate metabolism (5)
- Androgen and estrogen metabolism (4)
- Ascorbate and aldarate metabolism (4)
- Autoimmune thyroid disease (4)
- Circadian rhythm - mammal (4)
- DNA replication (4)
- Drug metabolism - other enzymes (4)
- Fatty acid elongation in mitochondria (4)
- Methane metabolism (4)
- Mismatch repair (4)
- Pantothenate and CoA biosynthesis (4)
- Phenylalanine metabolism (4)
- Primary bile acid biosynthesis (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Complement and coagulation cascades (3)
- Glycerolipid metabolism (3)
- Other glycan degradation (3)
- Pentose phosphate pathway (3)
- SNARE interactions in vesicular transport (3)
- Selenoamino acid metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Caffeine metabolism (2)
- Folate biosynthesis (2)
- Glycerophospholipid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Homologous recombination (2)
- Keratan sulfate biosynthesis (2)
- Limonene and pinene degradation (2)
- Lysine degradation (2)
- N-Glycan biosynthesis (2)
- Nicotinate and nicotinamide metabolism (2)
- Nitrogen metabolism (2)
- Pentose and glucuronate interconversions (2)
- Vitamin B6 metabolism (2)
- leucine and isoleucine biosynthesis (2)
- Asthma (1)
- Biosynthesis of unsaturated fatty acids (1)
- Chondroitin sulfate biosynthesis (1)
- Ether lipid metabolism (1)
- Heparan sulfate biosynthesis (1)
- Linoleic acid metabolism (1)
- RNA polymerase (1)
- Ribosome (1)
- Steroid biosynthesis (1)