lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
Applications | FC, IHC |
Reactivities | Human |
Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
USD 379.00
In Stock
lFN-g Capture mouse monoclonal antibody, ELISA and Luminex validated, clone B140
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700016 |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
C1QA goat polyclonal antibody, FITC
Applications | ELISA, ID, IF, IHC, IP |
Reactivities | Human |
Conjugation | FITC |
Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit Polyclonal Anti-C1QA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
Applications | FC, IHC, IP |
Reactivities | Human |
Complement C3 (C3) rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | C3b (C3c+C3d) has a molecular weight of 170,000. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
Applications | ELISA, FN |
Reactivities | Human |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
C1QA rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal C1QC Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit polyclonal C1QB Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB. |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
Rabbit Polyclonal Anti-C8G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
C2 rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | The C2 component of human complement is a single-chain polypeptide with a molecular weight of 110,000. It is present in plasma in an average concentration of 25 μg/ml. The activated form of C2 combines with the activated C4 to form a complex with C3-convertase activity in the classical pathway of complement activation. C2 is isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 rabbit polyclonal antibody, Serum
Applications | ID, IHC, IP |
Reactivities | Human |
Immunogen | C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Complement C7 (C7) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 375-403 amino acids from the Center region of human C7 |
IL10 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084) |
Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-Interferon gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
USD 590.00
5 Days
Complement Component 6 (C6) mouse monoclonal antibody, clone 056B-214.2.4.2, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
Applications | E |
Reactivities | Human, Monkey |
Conjugation | Biotin |
USD 590.00
5 Days
Complement C7 (C7) mouse monoclonal antibody, clone 030-113.7.5.4, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, FITC
Applications | FC, IHC |
Reactivities | Human |
Conjugation | FITC |
Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ. |
Complement C4A (C4A) rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | C4 and C2 represent substrates for activated C1. Both components are present in serum in an inert form. C4 is composed of 3 polypeptide chains of three different types, , , . One of the chains is cleaved by the action of activated C1, resulting in activation of C4 exposing an binding site for the next component in the sequence, C2. C4 has a molecular weight of 205.000 and is present in plasma in an average concentration of 600 μg/ml. The activation of C4 yields two peptide fragments: C4a (MW 8,000) and C4b (MW 198,000). This process shows a considerable degree of similarity to the activation of the components C3 and C5. The C4 is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 rabbit polyclonal antibody, Serum
Applications | ID, IP, R |
Reactivities | Guinea Pig |
Immunogen | The protein is isolated and purified from pooled normal Guinea Pig serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal antibody to Complement C2 (complement component 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681) |