Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
FAS Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAS |
HLA-DRB3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-DRB3 |
Anti-Human IL-4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-Granzyme B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Granzyme B Antibody: A synthesized peptide derived from human Granzyme B |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Rabbit Polyclonal Anti-Interferon gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Rabbit Polyclonal Anti-FAS ligand Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
Mouse Monoclonal Anti-CD80 Antibody [11C12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [12D9]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Fas Ligand Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
Rabbit Polyclonal Fas Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified
Applications | ELISA, FC, IP |
Reactivities | Human |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
Applications | E |
Reactivities | Human, Monkey |
Conjugation | Biotin |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free
Applications | FC, IHC, WB |
Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
IL2 mouse monoclonal antibody, clone B-G5, Azide Free
Applications | FC, FN, WB |
Reactivities | Human |
IL12A mouse monoclonal antibody, clone B-T21, Azide Free
Applications | FC, FN |
Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, FITC
Applications | FC, IHC |
Reactivities | Human |
Conjugation | FITC |
Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ. |
IL12A rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
HLA-DOA rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
HLADQA1 (HLA-DQA1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 56-84 amino acids from the Central region of Human HLA class II DQ alpha 1 / HLA-DQA1 |
IL12B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B. |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068) |
Rabbit polyclonal anti-IL4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL4. |
Rabbit polyclonal anti-HLA-DOA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Mouse Anti-Human CD95 (APO-1/Fas) Purified
Applications | FC |
Reactivities | Human |
Mouse Anti-Human HLA-DR Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal IL4 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit polyclonal CD28 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Mouse monoclonal HLA-G Antibody(Ascites)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal HLA-B Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Anti-Human IL-2 Goat Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Anti-Human IL-2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Anti-Human IFN-? Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IFN-γ |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |