Germany
Japan
United Kingdom
China
Products
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal Ret (Ab-905) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Ret around the phosphorylation site of tyrosine 905 (D-S-YP-V-K). |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit Polyclonal Ret (Tyr1062) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Ret around the phosphorylation site of Tyrosine 1062 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Thyroid cancer
Filter by
Target Symbol
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1358)
- Transcription Factors (579)
- Protein Kinase (549)
- Stem cell - Pluripotency (353)
- ES Cell Differentiation/IPS (276)
- Transmembrane (150)
- Stem cell relevant signaling - JAK/STAT signaling pathway (98)
- Stem cell relevant signaling - Wnt Signaling pathway (98)
- Embryonic stem cells (61)
- Induced pluripotent stem cells (61)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (61)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Nuclear Hormone Receptor (35)
- Adult stem cells (11)