Products

View as table Download

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Human, Macaque, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Rabbit polyclonal STAT2 phospho Y690 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Macaque, Vervet Monkey, Rat, Dog, Pig, Horse, Mouse, Bovine
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein.

Rabbit Polyclonal Anti-TAAR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Rabbit polyclonal PPAR Gamma 2 antibody

Applications WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the amino terminus of human PPAR gamma 2.

Rabbit Polyclonal Anti-KCNN3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR

Rabbit Polyclonal Anti-SPSB2 Antibody

Applications IHC, WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2. Synthetic peptide located within the following region: IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG

Mouse Monoclonal Anti-IFN-gamma Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Rabbit polyclonal anti-CASZ1 antibody

Applications WB
Reactivities Human, Mouse, Drosophila, Chimpanzee and Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein.

Rabbit polyclonal anti-Pogz antibody

Applications WB
Reactivities Human, Dog, Short-tailed Opossum, Bovine, Rat, Chimpanzee, Macaque, Olive Baboon, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of mouse Pogz protein.

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Mouse monoclonal anti-LGR4 antibody

Applications IHC
Reactivities Chimpanzee, Human, Macaque
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IFN-gamma Antibody, FITC conjugated

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IFN-gamma Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Rabbit Polyclonal Anti-IFN-gamma Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated
Immunogen For immunization recombinant human IFN-gamma (E.coli-derived) is used

Rabbit Polyclonal Anti-IL-12p70 Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated
Immunogen For immunization recombinant human IL-12p70 (CHO-derived) is used

Rabbit Polyclonal Anti-IL-12p70 Antibody, Biotin conjugated

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated
Immunogen For immunization recombinant human IL-12p70 (CHO-derived) is used

Mouse Monoclonal Anti-IFN-gamma Antibody,Biotin conjugated

Reactivities Rhesus Macaque, Cynomolgus Monkey, Human, Chimpanzee
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Rhesus Macaque, Cynomolgus Monkey, Human
Conjugation Unconjugated

Recombinant Anti-Fc gamma receptor III (Clone 3G8)

Applications FC, IHC, IP
Reactivities Chimpanzee, Human, Macaque, Marmoset, Monkey, Baboon, Cynomolgus
Conjugation Unconjugated

Recombinant Anti-Fc gamma receptor III (Clone 3G8)

Applications FC, IHC, IP
Reactivities Chimpanzee, Human, Macaque, Marmoset, Monkey, Baboon, Cynomolgus
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.