UL49 (NC_001806) Virus Tagged ORF Clone
CAT#: VC100837
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044651
View other clones from "Virus" (62)
Product Images
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Symbol | UL49 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC100837 represents NCBI reference of NP_044651 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAAGCAGGCGCAGCGTGAAGAGTGGACCCAGGGAGGTGCCACGGGATGAATATGAGGACCTGTACT ATACCCCATCATCCGGCATGGCATCTCCGGACTCCCCCCCTGACACTTCACGGAGAGGAGCCCTGCAGAC TAGAAGCCGGCAGCGCGGCGAGGTTAGGTTCGTACAGTATGATGAGTCCGATTACGCCCTCTATGGCGGC AGTTCTTCCGAGGACGATGAACATCCCGAAGTGCCAAGGACTCGGAGACCTGTGAGCGGAGCTGTCTTGT CCGGCCCTGGTCCTGCAAGAGCTCCCCCTCCCCCGGCTGGATCAGGTGGAGCTGGCAGAACTCCTACTAC CGCCCCTAGAGCCCCCAGGACGCAAAGAGTGGCCACTAAGGCACCCGCTGCCCCCGCAGCAGAAACGACC CGGGGCCGGAAAAGTGCGCAGCCAGAGAGCGCAGCCCTCCCTGATGCACCAGCTAGCACAGCACCTACCA GAAGCAAAACACCAGCGCAGGGACTCGCTCGCAAACTGCACTTTAGCACAGCCCCCCCTAATCCAGACGC GCCGTGGACTCCCCGAGTTGCAGGGTTTAACAAGAGGGTTTTCTGTGCAGCTGTCGGACGGCTTGCTGCA ATGCATGCTAGGATGGCCGCTGTGCAGCTGTGGGACATGAGCCGACCCAGAACGGATGAGGATCTGAACG AACTTCTGGGCATCACCACTATTAGGGTAACCGTGTGCGAGGGTAAGAACCTGTTGCAGAGGGCAAATGA GCTTGTGAATCCAGATGTGGTTCAAGATGTGGATGCCGCCACTGCAACAAGGGGCCGCTCCGCCGCAAGC AGGCCTACCGAAAGACCCCGGGCTCCTGCCCGCTCTGCAAGCCGGCCCAGAAGACCAGTGGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100837 representing NP_044651
Red=Cloning sites Green=Tags MTSRRSVKSGPREVPRDEYEDLYYTPSSGMASPDSPPDTSRRGALQTRSRQRGEVRFVQYDESDYALYGG SSSEDDEHPEVPRTRRPVSGAVLSGPGPARAPPPPAGSGGAGRTPTTAPRAPRTQRVATKAPAAPAAETT RGRKSAQPESAALPDAPASTAPTRSKTPAQGLARKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAA MHARMAAVQLWDMSRPRTDEDLNELLGITTIRVTVCEGKNLLQRANELVNPDVVQDVDAATATRGRSAAS RPTERPRAPARSASRPRRPVE TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_001806 |
| ORF Size | 903 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Reference Data | |
| RefSeq | NC_001806.1, NP_044651 |
| RefSeq ORF | 903 |
| Locus ID | 2703417 |
| MW | 32.3 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC100788 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 1], codon optimized for human cell expression, NP_044602 |
USD 400.00 |
|
| VC100789 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 1], codon optimized for human cell expression, NP_044603 |
USD 420.00 |
|
| VC100790 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044604 |
USD 400.00 |
|
| VC100791 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 1], codon optimized for human cell expression, NP_044605 |
USD 400.00 |
|
| VC100792 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044606 |
USD 1,400.00 |
|
| VC100793 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044607 |
USD 1,070.00 |
|
| VC100794 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 1], codon optimized for human cell expression, NP_044608 |
USD 400.00 |
|
| VC100795 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044609 |
USD 1,190.00 |
|
| VC100796 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 1], codon optimized for human cell expression, NP_044610 |
USD 1,360.00 |
|
| VC100797 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 1], codon optimized for human cell expression, NP_044611 |
USD 610.00 |
|
| VC100798 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044612 |
USD 400.00 |
|
| VC100799 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 1], codon optimized for human cell expression, NP_044613 |
USD 790.00 |
|
| VC100800 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044614 |
USD 660.00 |
|
| VC100801 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 1], codon optimized for human cell expression, NP_044615 |
USD 400.00 |
|
| VC100802 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044616 |
USD 1,160.00 |
|
| VC100803 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044617 |
USD 470.00 |
|
| VC100805 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044619 |
USD 400.00 |
|
| VC100806 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044620 |
USD 2,180.00 |
|
| VC100807 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 1], codon optimized for human cell expression, NP_044621 |
USD 400.00 |
|
| VC100808 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 1], codon optimized for human cell expression, NP_044622 |
USD 680.00 |
|
| VC100809 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 1], codon optimized for human cell expression, NP_044623 |
USD 1,340.00 |
|
| VC100810 | Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044624 |
USD 470.00 |
|
| VC100811 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 1], codon optimized for human cell expression, NP_044625 |
USD 400.00 |
|
| VC100812 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 1], codon optimized for human cell expression, NP_044626 |
USD 740.00 |
|
| VC100814 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044628 |
USD 400.00 |
|
| VC100815 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044629 |
USD 1,440.00 |
|
| VC100816 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044630 |
USD 1,260.00 |
|
| VC100817 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044631 |
USD 1,900.00 |
|
| VC100818 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044632 |
USD 1,970.00 |
|
| VC100819 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044633 |
USD 400.00 |
|
| VC100820 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 1], codon optimized for human cell expression, NP_044634 |
USD 760.00 |
|
| VC100821 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 1], codon optimized for human cell expression, NP_044635 |
USD 400.00 |
|
| VC100822 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044636 |
USD 400.00 |
|
| VC100823 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044637 |
USD 400.00 |
|
| VC100825 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 1], codon optimized for human cell expression, NP_044639 |
USD 1,780.00 |
|
| VC100826 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044640 |
USD 600.00 |
|
| VC100828 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044642 |
USD 430.00 |
|
| VC100829 | Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044643 |
USD 630.00 |
|
| VC100830 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044644 |
USD 630.00 |
|
| VC100832 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 1], codon optimized for human cell expression, NP_044646 |
USD 650.00 |
|
| VC100833 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 1], codon optimized for human cell expression, NP_044647 |
USD 400.00 |
|
| VC100834 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 1], codon optimized for human cell expression, NP_044648 |
USD 1,140.00 |
|
| VC100836 | Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044650 |
USD 630.00 |
|
| VC100838 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 1], codon optimized for human cell expression, NP_044652 |
USD 400.00 |
|
| VC100839 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 1], codon optimized for human cell expression, NP_044653 |
USD 470.00 |
|
| VC100840 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 1], codon optimized for human cell expression, NP_044654 |
USD 400.00 |
|
| VC100841 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044655 |
USD 1,690.00 |
|
| VC100842 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 1], codon optimized for human cell expression, NP_044656 |
USD 430.00 |
|
| VC100844 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 1], codon optimized for human cell expression, NP_044658 |
USD 400.00 |
|
| VC100845 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 1], codon optimized for human cell expression, NP_044659 |
USD 400.00 |
|
| VC100849 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044663 |
USD 540.00 |
|
| VC100850 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044664 |
USD 400.00 |
|
| VC100851 | Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044665 |
USD 620.00 |
|
| VC100852 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein G [Human herpesvirus 1], codon optimized for human cell expression, NP_044666 |
USD 400.00 |
|
| VC100853 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 1], codon optimized for human cell expression, NP_044667 |
USD 400.00 |
|
| VC100854 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 1], codon optimized for human cell expression, NP_044668 |
USD 490.00 |
|
| VC100855 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 1], codon optimized for human cell expression, NP_044669 |
USD 490.00 |
|
| VC100856 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 1], codon optimized for human cell expression, NP_044670 |
USD 700.00 |
|
| VC100857 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 1], codon optimized for human cell expression, NP_044671 |
USD 400.00 |
|
| VC100858 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 1], codon optimized for human cell expression, NP_044672 |
USD 400.00 |
|
| VC100859 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 1], codon optimized for human cell expression, NP_044673 |
USD 400.00 |
|
| VC100861 | Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 1], codon optimized for human cell expression, NP_044675 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China
