ORF74 (NC_009333) Virus Tagged ORF Clone
CAT#: VC101713
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for ORF74 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129433
"NC_009333" in other vectors (82)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ORF74 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101713 represents NCBI reference of YP_001129433 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGCCGAAGATTTTCTGACAATATTCCTGGACGACGATGAAAGCTGGAACGAGACCCTCAATATGA GCGGCTATGACTATTCCGGGAATTTTTCCCTCGAAGTGAGCGTGTGCGAGATGACCACTGTGGTGCCTTA CACTTGGAACGTTGGGATCCTGAGCCTCATCTTCCTGATCAATGTGTTGGGCAACGGTTTGGTGACCTAT ATCTTTTGTAAGCACAGGTCCCGCGCAGGCGCGATTGACATTCTGCTCCTCGGCATCTGCTTGAATTCTC TGTGCTTGTCCATTTCACTGCTGGCCGAGGTCTTGATGTTTCTTTTCCCTAATATCATCAGCACTGGCCT GTGCAGGTTGGAGATCTTCTTTTATTACTTGTATGTTTATTTGGATATCTTCAGCGTCGTCTGCGTGTCT CTGGTCAGGTACCTGTTGGTTGCTTATAGTACACGAAGCTGGCCTAAAAAGCAAAGTCTTGGATGGGTGT TGACCAGTGCTGCTTTGTTGATCGCTCTGGTTCTGTCAGGAGACGCCTGTAGACACCGAAGCAGAGTTGT TGACCCGGTGAGTAAGCAGGCCATGTGTTATGAGAATGCAGGAAACATGACCGCTGACTGGAGGTTGCAT GTCCGGACAGTGTCAGTCACGGCGGGTTTTCTCCTGCCTCTCGCTCTTCTGATCCTTTTTTATGCACTGA CCTGGTGCGTTGTTCGAAGAACTAAACTTCAGGCCAGACGGAAGGTTAGGGGAGTGATAGTGGCTGTGGT GCTGTTGTTTTTTGTGTTCTGCTTCCCGTACCACGTGCTGAACCTGCTTGATACATTGCTTCGCCGGCGG TGGATCCGGGATAGTTGCTACACCAGAGGACTGATTAACGTGGGACTGGCGGTAACCTCACTTTTGCAGG CACTCTACTCCGCTGTCGTGCCTCTGATTTACAGTTGTTTGGGCTCTCTCTTCCGGCAGAGGATGTACGG TCTGTTTCAAAGCCTGCGCCAGTCCTTCATGAGCGGAGCAACCACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101713 representing YP_001129433
Red=Cloning sites Green=Tags MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTVVPYTWNVGILSLIFLINVLGNGLVTY IFCKHRSRAGAIDILLLGICLNSLCLSISLLAEVLMFLFPNIISTGLCRLEIFFYYLYVYLDIFSVVCVS LVRYLLVAYSTRSWPKKQSLGWVLTSAALLIALVLSGDACRHRSRVVDPVSKQAMCYENAGNMTADWRLH VRTVSVTAGFLLPLALLILFYALTWCVVRRTKLQARRKVRGVIVAVVLLFFVFCFPYHVLNLLDTLLRRR WIRDSCYTRGLINVGLAVTSLLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQSFMSGATT TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_009333 |
ORF Size | 1026 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_009333.1, YP_001129433 |
RefSeq ORF | 1026 |
Locus ID | 4961460 |
MW | 38.7 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101630 | Myc-DDK-tagged ORF clone of viral ORF for K1 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129350 |
USD 400.00 |
|
VC101631 | Myc-DDK-tagged ORF clone of viral ORF for KCP [Human herpesvirus 8], codon optimized for human cell expression, YP_001129351 |
USD 700.00 |
|
VC101632 | Myc-DDK-tagged ORF clone of viral ORF for ORF6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129352 |
USD 1,800.00 |
|
VC101633 | Myc-DDK-tagged ORF clone of viral ORF for ORF7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129353 |
USD 1,100.00 |
|
VC101634 | Myc-DDK-tagged ORF clone of viral ORF for ORF8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129354 |
USD 1,350.00 |
|
VC101635 | Myc-DDK-tagged ORF clone of viral ORF for ORF9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129355 |
USD 1,620.00 |
|
VC101636 | Myc-DDK-tagged ORF clone of viral ORF for ORF10 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129356 |
USD 540.00 |
|
VC101637 | Myc-DDK-tagged ORF clone of viral ORF for ORF11 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129357 |
USD 520.00 |
|
VC101638 | Myc-DDK-tagged ORF clone of viral ORF for K2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129358 |
USD 400.00 |
|
VC101639 | Myc-DDK-tagged ORF clone of viral ORF for ORF2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129359 |
USD 400.00 |
|
VC101640 | Myc-DDK-tagged ORF clone of viral ORF for K3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129360 |
USD 400.00 |
|
VC101641 | Myc-DDK-tagged ORF clone of viral ORF for ORF70 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129361 |
USD 420.00 |
|
VC101642 | Myc-DDK-tagged ORF clone of viral ORF for K4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129362 |
USD 400.00 |
|
VC101643 | Myc-DDK-tagged ORF clone of viral ORF for K41 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129363 |
USD 400.00 |
|
VC101644 | Myc-DDK-tagged ORF clone of viral ORF for K42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129364 |
USD 400.00 |
|
VC101645 | Myc-DDK-tagged ORF clone of viral ORF for K5 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129365 |
USD 400.00 |
|
VC101646 | Myc-DDK-tagged ORF clone of viral ORF for K6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129366 |
USD 400.00 |
|
VC101647 | Myc-DDK-tagged ORF clone of viral ORF for K7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129367 |
USD 400.00 |
|
VC101648 | Myc-DDK-tagged ORF clone of viral ORF for ORF16 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129368 |
USD 400.00 |
|
VC101649 | Myc-DDK-tagged ORF clone of viral ORF for ORF17 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129369 |
USD 680.00 |
|
VC101650 | Myc-DDK-tagged ORF clone of viral ORF for ORF175 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129370 |
USD 400.00 |
|
VC101651 | Myc-DDK-tagged ORF clone of viral ORF for ORF18 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129371 |
USD 400.00 |
|
VC101652 | Myc-DDK-tagged ORF clone of viral ORF for ORF19 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129372 |
USD 700.00 |
|
VC101653 | Myc-DDK-tagged ORF clone of viral ORF for ORF20 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129373 |
USD 400.00 |
|
VC101654 | Myc-DDK-tagged ORF clone of viral ORF for ORF21 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129374 |
USD 740.00 |
|
VC101655 | Myc-DDK-tagged ORF clone of viral ORF for ORF22 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129375 |
USD 1,160.00 |
|
VC101656 | Myc-DDK-tagged ORF clone of viral ORF for ORF23 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129376 |
USD 500.00 |
|
VC101657 | Myc-DDK-tagged ORF clone of viral ORF for ORF24 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129377 |
USD 1,190.00 |
|
VC101658 | Myc-DDK-tagged ORF clone of viral ORF for ORF25 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129378 |
USD 2,180.00 |
|
VC101659 | Myc-DDK-tagged ORF clone of viral ORF for ORF26 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129379 |
USD 400.00 |
|
VC101660 | Myc-DDK-tagged ORF clone of viral ORF for ORF27 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129380 |
USD 400.00 |
|
VC101661 | Myc-DDK-tagged ORF clone of viral ORF for ORF28 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129381 |
USD 400.00 |
|
VC101662 | Myc-DDK-tagged ORF clone of viral ORF for ORF29 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129382 |
USD 1,090.00 |
|
VC101663 | Myc-DDK-tagged ORF clone of viral ORF for ORF30 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129383 |
USD 400.00 |
|
VC101664 | Myc-DDK-tagged ORF clone of viral ORF for ORF31 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129384 |
USD 400.00 |
|
VC101665 | Myc-DDK-tagged ORF clone of viral ORF for ORF32 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129385 |
USD 580.00 |
|
VC101666 | Myc-DDK-tagged ORF clone of viral ORF for ORF33 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129386 |
USD 420.00 |
|
VC101667 | Myc-DDK-tagged ORF clone of viral ORF for ORF34 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129387 |
USD 400.00 |
|
VC101668 | Myc-DDK-tagged ORF clone of viral ORF for ORF35 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129388 |
USD 400.00 |
|
VC101669 | Myc-DDK-tagged ORF clone of viral ORF for ORF36 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129389 |
USD 570.00 |
|
VC101670 | Myc-DDK-tagged ORF clone of viral ORF for ORF37 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129390 |
USD 620.00 |
|
VC101671 | Myc-DDK-tagged ORF clone of viral ORF for ORF38 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129391 |
USD 400.00 |
|
VC101672 | Myc-DDK-tagged ORF clone of viral ORF for ORF39 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129392 |
USD 500.00 |
|
VC101673 | Myc-DDK-tagged ORF clone of viral ORF for ORF40 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129393 |
USD 1,060.00 |
|
VC101674 | Myc-DDK-tagged ORF clone of viral ORF for ORF42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129394 |
USD 400.00 |
|
VC101675 | Myc-DDK-tagged ORF clone of viral ORF for ORF43 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129395 |
USD 770.00 |
|
VC101676 | Myc-DDK-tagged ORF clone of viral ORF for ORF44 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129396 |
USD 1,260.00 |
|
VC101677 | Myc-DDK-tagged ORF clone of viral ORF for ORF45 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129397 |
USD 520.00 |
|
VC101678 | Myc-DDK-tagged ORF clone of viral ORF for ORF46 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129398 |
USD 400.00 |
|
VC101679 | Myc-DDK-tagged ORF clone of viral ORF for ORF47 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129399 |
USD 400.00 |
|
VC101680 | Myc-DDK-tagged ORF clone of viral ORF for ORF48 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129400 |
USD 500.00 |
|
VC101681 | Myc-DDK-tagged ORF clone of viral ORF for ORF50 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129401 |
USD 1,100.00 |
|
VC101682 | Myc-DDK-tagged ORF clone of viral ORF for ORF49 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129402 |
USD 400.00 |
|
VC101683 | Myc-DDK-tagged ORF clone of viral ORF for K8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129403 |
USD 400.00 |
|
VC101684 | Myc-DDK-tagged ORF clone of viral ORF for K81 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129404 |
USD 400.00 |
|
VC101685 | Myc-DDK-tagged ORF clone of viral ORF for ORF52 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129405 |
USD 400.00 |
|
VC101686 | Myc-DDK-tagged ORF clone of viral ORF for ORF53 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129406 |
USD 400.00 |
|
VC101687 | Myc-DDK-tagged ORF clone of viral ORF for ORF54 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129407 |
USD 400.00 |
|
VC101688 | Myc-DDK-tagged ORF clone of viral ORF for ORF55 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129408 |
USD 400.00 |
|
VC101689 | Myc-DDK-tagged ORF clone of viral ORF for ORF56 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129409 |
USD 1,340.00 |
|
VC101690 | Myc-DDK-tagged ORF clone of viral ORF for ORF57 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129410 |
USD 590.00 |
|
VC101691 | Myc-DDK-tagged ORF clone of viral ORF for K9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129411 |
USD 580.00 |
|
VC101692 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129412 |
USD 1,450.00 |
|
VC101693 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129413 |
USD 720.00 |
|
VC101695 | Myc-DDK-tagged ORF clone of viral ORF for ORF58 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129415 |
USD 450.00 |
|
VC101696 | Myc-DDK-tagged ORF clone of viral ORF for ORF59 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129416 |
USD 500.00 |
|
VC101697 | Myc-DDK-tagged ORF clone of viral ORF for ORF60 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129417 |
USD 400.00 |
|
VC101698 | Myc-DDK-tagged ORF clone of viral ORF for ORF61 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129418 |
USD 1,270.00 |
|
VC101699 | Myc-DDK-tagged ORF clone of viral ORF for ORF62 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129419 |
USD 400.00 |
|
VC101700 | Myc-DDK-tagged ORF clone of viral ORF for ORF63 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129420 |
USD 1,470.00 |
|
VC101702 | Myc-DDK-tagged ORF clone of viral ORF for ORF65 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129422 |
USD 400.00 |
|
VC101703 | Myc-DDK-tagged ORF clone of viral ORF for ORF66 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129423 |
USD 550.00 |
|
VC101704 | Myc-DDK-tagged ORF clone of viral ORF for ORF67 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129424 |
USD 400.00 |
|
VC101705 | Myc-DDK-tagged ORF clone of viral ORF for ORF67A [Human herpesvirus 8], codon optimized for human cell expression, YP_001129425 |
USD 400.00 |
|
VC101706 | Myc-DDK-tagged ORF clone of viral ORF for ORF68 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129426 |
USD 600.00 |
|
VC101707 | Myc-DDK-tagged ORF clone of viral ORF for ORF69 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129427 |
USD 400.00 |
|
VC101708 | Myc-DDK-tagged ORF clone of viral ORF for K12 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129428 |
USD 400.00 |
|
VC101709 | Myc-DDK-tagged ORF clone of viral ORF for K13 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129429 |
USD 400.00 |
|
VC101710 | Myc-DDK-tagged ORF clone of viral ORF for ORF72 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129430 |
USD 400.00 |
|
VC101712 | Myc-DDK-tagged ORF clone of viral ORF for K14 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129432 |
USD 400.00 |
|
VC101714 | Myc-DDK-tagged ORF clone of viral ORF for ORF75 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129434 |
USD 2,060.00 |
|
VC101715 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129435 |
USD 630.00 |
{0} Product Review(s)
Be the first one to submit a review