Rabbit Polyclonal Anti-Igf2bp3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Igf2bp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI |
Rabbit Polyclonal Anti-Cdc25b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
Rabbit Polyclonal Anti-Serpinc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
Rabbit Polyclonal Anti-REN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
Rabbit Polyclonal Anti-CKM Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL |
Rabbit Polyclonal Anti-CKM Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI |
Rabbit Polyclonal Anti-Masp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |
Rabbit Polyclonal Anti-Hspb7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hspb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF |
Rabbit Polyclonal Anti-Hspb7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hspb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI |
Rabbit Polyclonal Anti-CYP2B6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-Cyp4b1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cyp4b1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cyp4b1. Synthetic peptide located within the following region: FRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPE |
Rabbit Polyclonal Anti-CRMP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI |
Rabbit Polyclonal Anti-CRMP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the C terminal of human CRMP1. Synthetic peptide located within the following region: SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS |
Rabbit Polyclonal Anti-Cpa3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cpa3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMV |
Rabbit Polyclonal Anti-Rasa1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rasa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT |
Rabbit Polyclonal Anti-Stc1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG |
Rabbit Polyclonal Anti-Lgals4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS |
Rabbit Polyclonal Anti-Tekt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tekt1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tekt1. Synthetic peptide located within the following region: EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL |
Rabbit Polyclonal Anti-Tcn2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tcn2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS |
Rabbit Polyclonal Anti-P4HB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P4HB antibody: synthetic peptide directed towards the C terminal of human P4HB. Synthetic peptide located within the following region: DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI |
Rabbit Polyclonal Anti-Atp5f1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp5f1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV |
Rabbit Polyclonal Anti-Atp5c1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atp5c1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Atp5c1. Synthetic peptide located within the following region: VRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGT |
Rabbit Polyclonal Anti-Mdh1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mdh1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mdh1. Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT |
Rabbit Polyclonal Anti-Ankrd13c Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ankrd13c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c. Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK |
Rabbit Polyclonal Anti-Cfl2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cfl2 antibody is: synthetic peptide directed towards the C-terminal region of Cfl2. Synthetic peptide located within the following region: FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK |
Rabbit Polyclonal Anti-HPRT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Rabbit Polyclonal Anti-Sbk1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sbk1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GSRPSPPSVGPVVPVPVPVPVPVPEAGLAPPAPPGRTDGRTDKSKGQVVL |
Rabbit Polyclonal Anti-Hmgcs1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hmgcs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hmgcs1. Synthetic peptide located within the following region: LVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLP |
Rabbit Polyclonal Anti-LAMB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMB1 antibody: synthetic peptide directed towards the middle region of human LAMB1. Synthetic peptide located within the following region: VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENL |
Rabbit Polyclonal Anti-Rngtt Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rngtt antibody is: synthetic peptide directed towards the N-terminal region of Rngtt. Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE |
Rabbit Polyclonal Anti-Gyg Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gyg antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ |
Rabbit Polyclonal Anti-Pcmtd2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pcmtd2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Pcmtd2. Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV |
Rabbit Polyclonal Anti-Qtrtd1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Qtrtd1 antibody is: synthetic peptide directed towards the C-terminal region of Qtrtd1. Synthetic peptide located within the following region: EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE |
Germany
Japan
United Kingdom
China