Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Primary Antibodies
View as table Download
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
VDAC1 (N-term) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Rabbit polyclonal anti-GJA3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GJA3. |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Anti-KCNAB3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB3 antibody: synthetic peptide directed towards the N terminal of human KCNAB3. Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV |
Rabbit Polyclonal Anti-GJA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
GJA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human |
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%). |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Ion Channels: Other
Filter by
Category
Target Symbol
- GJA1 (9)
- VDAC1 (5)
- AQP1 (4)
- CLIC1 (3)
- CYBB (3)
- GJB1 (3)
- KCNH6 (3)
- KCNMB3 (3)
- TNFAIP1 (3)
- ASIC1 (2)
- BEST3 (2)
- BEST4 (2)
- CACNB1 (2)
- CLCA4 (2)
- CLIC4 (2)
- CLIC5 (2)
- GJC1 (2)
- GJD2 (2)
- KCNAB2 (2)
- KCNE3 (2)
- KCNMB2 (2)
- KCTD15 (2)
- NOX1 (2)
- NUDT9 (2)
- SCNN1A (2)
- VDAC2 (2)
- ABCC4 (1)
- ASIC2 (1)
- ASIC3 (1)
- BEST1 (1)
- CACNA2D2 (1)
- CACNB2 (1)
- CACNG6 (1)
- CATSPER1 (1)
- CATSPER2 (1)
- CATSPER3 (1)
- CATSPER4 (1)
- CHRFAM7A (1)
- CLCA1 (1)
- CLCC1 (1)
- CLCN1 (1)
- CLCN3 (1)
- CLCN4 (1)
- CLIC3 (1)
- CLNS1A (1)
- FXYD1 (1)
- FXYD5 (1)
- FXYD7 (1)
- GJA3 (1)
- GJA4 (1)
- GJA8 (1)
- GJB2 (1)
- GJB4 (1)
- GJB5 (1)
- GJC2 (1)
- KCNAB3 (1)
- KCNG3 (1)
- KCNH7 (1)
- KCNIP1 (1)
- KCNIP2 (1)
- KCNIP4 (1)
- KCNMB1 (1)
- KCNMB4 (1)
- KCTD13 (1)
- KCTD6 (1)
- MLC1 (1)
- SCNN1G (1)
- SHKBP1 (1)
- TPCN2 (1)
- VDAC3 (1)
Reactivities
Clonalities
Conjugates
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (14)
- Gap junction (11)
- Calcium signaling pathway (8)
- Huntington's disease (8)
- Parkinson's disease (8)
- Vascular smooth muscle contraction (7)
- Cardiac muscle contraction (5)
- Dilated cardiomyopathy (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Leukocyte transendothelial migration (5)
- MAPK signaling pathway (5)
- Taste transduction (4)
- Olfactory transduction (3)
- Purine metabolism (2)
- ABC transporters (1)