Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Polyclonal IRE1 alpha [p Ser724] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit (Does not react with: Primate) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 724 of the human IRE1 alpha protein. [Swiss-Prot #O75460] |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit polyclonal ARRB1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARRB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-363 amino acids from the C-terminal region of human ARRB1. |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Antibody against RPS6KB1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human S6K (RPS6KB1). |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal ACTA1/Alpha-actin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACTA1/Alpha-actin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-375 amino acids from the C-terminal region of human ACTA1/Alpha-actin. |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
Rabbit polyclonal SCP2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Rabbit Polyclonal Antibody against APOE (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APOE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human APOE. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit Polyclonal antibody to CD98 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 89 and 433 of CD98 (Uniprot ID#P08195) |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697) |
Rabbit Polyclonal antibody to Epoxide hydrolase 1 (epoxide hydrolase 1, microsomal (xenobiotic))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 292 of EPHX1 (Uniprot ID#P07099) |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Rabbit Polyclonal antibody to DAP5 (eukaryotic translation initiation factor 4 gamma, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 194 of DAP5 |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
Rabbit Anti-Tryptophan Hydroxylase (Ser58) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser58 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-HSPA5 Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
| Conjugation | Unconjugated |
| Immunogen | Rat GRP78 (Bip) sythetic peptide (amino acids 645-654, C-terminus) conjugated to KLH. Identical to mouse and hamster GRP78 sequenes over residues EEDTSEKDEL. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit polyclonal anti-Decorin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 130 of human Decorin |
Rabbit polyclonal CASP3 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3. |
Germany
Japan
United Kingdom
China
