Primary Antibodies

View as table Download

Rabbit Polyclonal Folliculin Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N-terminal partial recombinant human FLCN protein [Swiss-Prot# Q8NFG4] expressed in E. coli.

Rabbit polyclonal p38 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig
Conjugation Unconjugated
Immunogen A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH.

Rabbit Polyclonal DUOX2 Antibody

Applications WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal GPR83 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250 of human GPR83 was used as the immunogen for this antibody.

Rabbit Polyclonal SR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121.

Rabbit Polyclonal SOX9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal active/cleaved Caspase 3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human caspase-3 protein was used as immunogen.

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated

Rabbit polyclonal Cpn10 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Cpn10 peptide AA 91-101

Rabbit Polyclonal Caspase-6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-6 protein was used as immunogen.

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

Rabbit Polyclonal beta Tubulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a portion of amino acids 400-450 of human b-tubulin was used as immunogen for this antibody, GenBank no. gi|27227551|gb|AAN85571.1|.

Rabbit Polyclonal Smad2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen.

Rabbit Polyclonal PLK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-200 of human PLK1 was used as the immunogen.

Rabbit Polyclonal HDAC9 Antibody

Applications WB
Reactivities Human, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human HDAC-9 was used as the immunogen.

Rabbit Polyclonal NQO-1 Antibody

Applications IHC, WB
Reactivities Canine, Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 250-274 of human NQO1 was used as the immunogen.

Rabbit Polyclonal HDAC9 [p Ser155] Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide containing phospho-serine 155 of human HDAC-7 was used as the immunogen.

Rabbit Polyclonal AMPD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 140-190 of human AMPDA1 was used as the immunogen.

Rabbit Polyclonal HIPK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 850-900 of human HIPK3 was used as the immunogen.

Rabbit Polyclonal Rab7a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 90-140 of human Rab7 protein was used as the immunogen for this antibody.

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Rabbit Polyclonal Kv1.2 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142]

Rabbit Polyclonal Kv1.2 Antibody

Applications IF
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142]

Rabbit polyclonal Hsp60 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Hsp60 produced through recombinant DNA methods in E.coli

Rabbit polyclonal SOD (Mn) Antibody

Applications IHC
Reactivities Bovine, Canine, Chicken, Guinea Pig, Gerbil, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Mn SOD

Rabbit polyclonal GRP78 (Bip) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine. Other species not yet tested
Conjugation Unconjugated
Immunogen Full length human GRP78 (Bip) his tagged at the N terminus

Rabbit Polyclonal Anti-Calcineurin A Antibody

Reactivities Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Calcineurin A peptide (AA 364-283)

Rabbit Polyclonal Anti-TNF-R1 Antibody

Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues

Rabbit Polyclonal 5-HT7 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1).

Rabbit Polyclonal VDAC2/3 Antibody

Applications WB
Reactivities Human, Bovine, Canine, Feline, Primate
Conjugation Unconjugated
Immunogen Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen.

Rabbit Polyclonal CRHR2/CRF2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken
Conjugation Unconjugated
Immunogen A portion of amino acids 75-125 of human CRHR2 was used as the immunogen.

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Canine, Feline, Human, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817]

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine, Feline, Hamster, Porcin
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817]

Rabbit Polyclonal Kv1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu
Conjugation Unconjugated
Immunogen Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family.

Rabbit Polyclonal Potassium Channel Kv3.1 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122]

Rabbit Polyclonal STAT3 [p Tyr705] Antibody

Applications WB
Reactivities Human, Mouse, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of human STAT3 protein containing a phosphorylated tyrosine residue at position 705 was used as the immunogen for this phospho antibody.

Rabbit Polyclonal MEK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen.

Rabbit Polyclonal MTSS1 Antibody

Applications WB
Reactivities Canine, Chicken, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 150-200 of human MTSS1 protein was used as the immunogen.

Rabbit Polyclonal Snail Antibody

Applications WB
Reactivities Human, Mouse, Canine, Equine
Conjugation Unconjugated
Immunogen A portion of amino acids 80-130 of human SNAI1 was used as the immunogen