Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-USP25 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen USP25 antibody was raised against a 17 amino acid peptide near the center of human USP25.

Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253)

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal TACE Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid.

USD 320.00

In Stock

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit Polyclonal Anti-UBIAD1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UBIAD1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human UBIAD1.

Rabbit Polyclonal Anti-NOSTRIN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOSTRIN antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NOSTRIN.

Rabbit Polyclonal Anti-LIMA1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen LIMA1 antibody was raised against an 18 amino acid peptide near the amino terminus of human LIMA1

Rabbit Polyclonal Anti-DTX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DTX4 antibody was raised against a 19 amino acid peptide near the center of human DTX4.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B.

Rabbit Polyclonal Anti-ATG4D Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4D antibody was raised against a 17 amino acid peptide near the amino terminus of human ATG4D.

Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT

USD 450.00

In Stock

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2

Rabbit Polyclonal Caspase-8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A.

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Rabbit Polyclonal antibody to Factor X (coagulation factor X)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 33 and 312 of Factor X (Uniprot ID#P00742)

Rabbit polyclonal HtrA1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HtrA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-147 amino acids from the N-terminal region of human HtrA1.

Plasminogen (PLG) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Mouse Monoclonal UCHL1 / PGP9.5 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

ADAM17 mouse monoclonal antibody, clone 1F6

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human

Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, Biotin

Applications ELISA, ID, IF, IHC, IP, WB
Reactivities Human
Conjugation Biotin
Immunogen The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, HRP

Applications ELISA, ID, IF, IHC, IP, WB
Reactivities Human
Conjugation HRP
Immunogen The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, Biotin

Applications ELISA, ID, IF, IHC, IP, WB
Reactivities Monkey
Conjugation Biotin
Immunogen Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP, WB
Reactivities Monkey
Conjugation FITC
Immunogen Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight antimicrobial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from monkey milk.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, HRP

Applications ELISA, ID, IF, IHC, IP, WB
Reactivities Monkey
Conjugation HRP
Immunogen Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP.

Rabbit Polyclonal Caspase-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1.

Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8)

Rabbit polyclonal anti-GRAK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRAK.

Rabbit polyclonal PCSK2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PCSK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-116 amino acids from the N-terminal region of human PCSK2.

Rabbit Polyclonal Cathepsin V Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

USP33 mouse monoclonal antibody, clone 5B5, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human

CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

AHNAK guinea pig polyclonal antibody, Serum

Applications IF, IHC, IP, WB
Reactivities Bovine, Human
Immunogen Synthetic peptides of Human Desmoyokin (D1a/b, D2a/b, D4a/b), coupled to KLH

Lactoferrin (LTF) goat polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, WB
Reactivities Human
Immunogen Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Lactoferrin (LTF) goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

ST14 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen ST14 antibody was raised against synthetic peptide - KLH conjugated

Lactoferrin (LTF) goat polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, WB
Reactivities Monkey
Immunogen Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from rhesus monkey milk.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Haptoglobin (HP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 296-322 amino acids from the Central region of Human Haptoglobin

TPSAB1 mouse monoclonal antibody, clone AA1, Purified

Applications ELISA, IF, IHC, WB
Reactivities Canine, Feline, Human, Monkey, Rat

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP.

Rabbit Polyclonal antibody to TPP1 (tripeptidyl peptidase I)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 66 and 324 of TPP1 (Uniprot ID#O14773)

Rabbit Polyclonal antibody to USP15 (ubiquitin specific peptidase 15)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 920 and 981 of USP15 (Uniprot ID#Q9Y4E8)