Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Primary Antibodies
.jpg?d=110x100 "User supplied image")
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 379.00
In Stock
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 379.00
In Stock
USD 428.00
In Stock
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Active filters
Reactivities
- Mouse
Applications
- IHC
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- MAP2K1 (105)
- NME1 (84)
- OTC (71)
- ERBB2 (67)
- MAP2K3 (57)
- ABCB1 (51)
- AKT1 (48)
- CTNNB1 (47)
- PCNA (47)
- ERCC1 (46)
- VSNL1 (46)
- TOP2A (44)
- JUN (43)
- PIK3C2A (43)
- APP (41)
- SENP2 (38)
- NCAM1 (37)
- ABAT (36)
- LOX (35)
- HSPD1 (34)
- BCL2 (33)
- ESR1 (33)
- MCM2 (33)
- VBP1 (33)
- AKR1A1 (31)
- F13A1 (31)
- LTA4H (31)
- PFKP (31)
- PIK3CG (31)
- PPP5C (31)
- ALDH1L1 (30)
- BTK (30)
- NPR3 (30)
- TYMS (30)
- UBE2G2 (30)
- GCH1 (29)
- MMP13 (29)
- MTOR (29)
- NR3C1 (29)
- PTPRE (29)
- SQSTM1 (29)
- FOS (28)
- L1CAM (28)
- STAT4 (28)
- ACAT2 (27)
- DEF6 (27)
- POR (27)
- UNG (27)
- EGFR (25)
- ERG (25)
- GLI1 (25)
- RAB21 (25)
- SNAP25 (25)
- PRKAR2A (24)
- RHOJ (24)
- TNNT2 (24)
- UPRT (24)
- RPA2 (23)
- RRM1 (23)
- BCL10 (22)
- CHEK2 (22)
- ID3 (22)
- NKX2-1 (22)
- PIK3R5 (22)
- PIM2 (22)
- PSMA6 (22)
- TH (22)
- TLK2 (22)
- USP7 (22)
- CMPK1 (21)
- GPR17 (21)
- KRT8 (21)
- LPL (21)
- NRBP1 (21)
- PSMB9 (21)
- RFXANK (21)
- RGS16 (21)
- SATB1 (21)
- SNX9 (21)
- TRMT2A (21)
- BECN1 (20)
- BRAF (20)
- CTNND1 (20)
- FMR1 (20)
- MAP2K4 (20)
- MME (20)
- PRKCE (20)
- SKIL (20)
- STAT5A (20)
- TP73 (20)
- CLOCK (19)
- GBA (19)
- MAPK1 (19)
- MLH1 (19)
- NEUROG1 (19)
- TNNI3 (19)
- CPM (18)
- DES (18)
- GBE1 (18)
- GPI (18)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (1560)
- Metabolic pathways (1411)
- Focal adhesion (955)
- MAPK signaling pathway (925)
- Prostate cancer (791)
- Neurotrophin signaling pathway (757)
- Colorectal cancer (754)
- ErbB signaling pathway (742)
- Toll-like receptor signaling pathway (637)
- Insulin signaling pathway (636)
- Regulation of actin cytoskeleton (635)
- Pancreatic cancer (631)
- T cell receptor signaling pathway (617)
- Endometrial cancer (607)
- Chemokine signaling pathway (605)
- Chronic myeloid leukemia (577)
- B cell receptor signaling pathway (559)
- Acute myeloid leukemia (549)
- Progesterone-mediated oocyte maturation (543)
- Renal cell carcinoma (542)
- Non-small cell lung cancer (538)
- Fc epsilon RI signaling pathway (534)
- Glioma (521)
- Melanoma (513)
- Apoptosis (455)
- GnRH signaling pathway (452)
- Fc gamma R-mediated phagocytosis (443)
- VEGF signaling pathway (437)
- Small cell lung cancer (428)
- Bladder cancer (415)
- Natural killer cell mediated cytotoxicity (405)
- Cell cycle (396)
- Wnt signaling pathway (395)
- Jak-STAT signaling pathway (386)
- Gap junction (371)
- Leukocyte transendothelial migration (352)
- Adherens junction (347)
- Oocyte meiosis (345)
- Melanogenesis (342)
- Calcium signaling pathway (322)
- Cytokine-cytokine receptor interaction (316)
- Neuroactive ligand-receptor interaction (314)
- Adipocytokine signaling pathway (308)
- Alzheimer's disease (299)
- mTOR signaling pathway (298)
- Vascular smooth muscle contraction (295)
- Long-term potentiation (285)
- Thyroid cancer (282)
- Purine metabolism (277)
- Type II diabetes mellitus (274)
- Long-term depression (270)
- Axon guidance (264)
- Endocytosis (263)
- Amyotrophic lateral sclerosis (ALS) (262)
- Tight junction (253)
- Epithelial cell signaling in Helicobacter pylori infection (250)
- Pyrimidine metabolism (235)
- TGF-beta signaling pathway (229)
- Prion diseases (224)
- Glycolysis / Gluconeogenesis (215)
- p53 signaling pathway (210)
- Phosphatidylinositol signaling system (192)
- Ubiquitin mediated proteolysis (190)
- Dorso-ventral axis formation (187)
- Huntington's disease (185)
- Nucleotide excision repair (185)
- Basal cell carcinoma (181)
- Pathogenic Escherichia coli infection (181)
- NOD-like receptor signaling pathway (178)
- Cell adhesion molecules (CAMs) (170)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (156)
- Dilated cardiomyopathy (153)
- Inositol phosphate metabolism (150)
- Arginine and proline metabolism (147)
- Parkinson's disease (147)
- Hypertrophic cardiomyopathy (HCM) (144)
- Base excision repair (140)
- DNA replication (139)
- Valine (138)
- RIG-I-like receptor signaling pathway (137)
- Mismatch repair (133)
- leucine and isoleucine degradation (133)
- Hedgehog signaling pathway (124)
- Butanoate metabolism (115)
- Alanine (111)
- Primary immunodeficiency (111)
- aspartate and glutamate metabolism (111)
- ABC transporters (109)
- Propanoate metabolism (108)
- Pyruvate metabolism (103)
- Tyrosine metabolism (100)
- Proteasome (99)
- ECM-receptor interaction (96)
- PPAR signaling pathway (96)
- Hematopoietic cell lineage (95)
- Notch signaling pathway (95)
- Complement and coagulation cascades (92)
- Fatty acid metabolism (92)
- Drug metabolism - cytochrome P450 (91)
- Antigen processing and presentation (87)
- Arachidonic acid metabolism (87)
- Lysosome (83)
- Glycerolipid metabolism (82)
- Metabolism of xenobiotics by cytochrome P450 (80)
- Pentose phosphate pathway (79)
- Type I diabetes mellitus (74)
- Retinol metabolism (73)
- Viral myocarditis (72)
- beta-Alanine metabolism (72)
- Tryptophan metabolism (70)
- Cytosolic DNA-sensing pathway (69)
- One carbon pool by folate (68)
- Cardiac muscle contraction (65)
- Fructose and mannose metabolism (65)
- Starch and sucrose metabolism (65)
- Vibrio cholerae infection (62)
- Glutathione metabolism (60)
- Renin-angiotensin system (60)
- Galactose metabolism (58)
- Citrate cycle (TCA cycle) (55)
- Lysine degradation (54)
- Histidine metabolism (53)
- Regulation of autophagy (49)
- Homologous recombination (45)
- RNA degradation (45)
- SNARE interactions in vesicular transport (44)
- Folate biosynthesis (43)
- Amino sugar and nucleotide sugar metabolism (42)
- Maturity onset diabetes of the young (42)
- Circadian rhythm - mammal (40)
- Spliceosome (40)
- Synthesis and degradation of ketone bodies (40)
- Cysteine and methionine metabolism (37)
- Glycine (37)
- Oxidative phosphorylation (37)
- serine and threonine metabolism (37)
- Sphingolipid metabolism (35)
- Phenylalanine metabolism (31)
- Olfactory transduction (30)
- Ribosome (30)
- Terpenoid backbone biosynthesis (30)
- Taste transduction (29)
- Drug metabolism - other enzymes (28)
- Methane metabolism (25)
- Non-homologous end-joining (24)
- Autoimmune thyroid disease (22)
- Other glycan degradation (22)
- Porphyrin and chlorophyll metabolism (22)
- Systemic lupus erythematosus (22)
- Allograft rejection (21)
- Glyoxylate and dicarboxylate metabolism (20)
- Graft-versus-host disease (20)
- Sulfur metabolism (20)
- Androgen and estrogen metabolism (19)
- Glycerophospholipid metabolism (19)
- Nitrogen metabolism (19)
- Primary bile acid biosynthesis (19)
- Fatty acid biosynthesis (18)
- Caffeine metabolism (17)
- Taurine and hypotaurine metabolism (17)
- Pantothenate and CoA biosynthesis (16)
- Selenoamino acid metabolism (16)
- Glycosaminoglycan degradation (15)
- Ether lipid metabolism (13)
- Ascorbate and aldarate metabolism (12)
- Linoleic acid metabolism (12)
- Steroid biosynthesis (11)
- leucine and isoleucine biosynthesis (11)
- Limonene and pinene degradation (10)
- Nicotinate and nicotinamide metabolism (9)
- Vitamin B6 metabolism (8)
- Basal transcription factors (7)
- Pentose and glucuronate interconversions (7)
- Aminoacyl-tRNA biosynthesis (6)
- Asthma (6)
- Fatty acid elongation in mitochondria (6)
- Riboflavin metabolism (6)
- C21-Steroid hormone metabolism (4)
- Biosynthesis of unsaturated fatty acids (3)
- O-Glycan biosynthesis (3)
- Protein export (3)
- alpha-Linolenic acid metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- N-Glycan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- D-Glutamine and D-glutamate metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Heparan sulfate biosynthesis (1)
- Phenylalanine (1)
- RNA polymerase (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)