Germany
Japan
United Kingdom
China
Primary Antibodies
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
USD 420.00
In Stock
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
USD 399.00
In Stock
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
USD 379.00
In Stock
USD 428.00
In Stock
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Druggable Genome
Filter by
Target Symbol
- MAP2K1 (173)
- MKI67 (138)
- TP53 (137)
- NME1 (134)
- OTC (117)
- LIPG (115)
- TG (114)
- KLK8 (113)
- NBN (107)
- PECAM1 (105)
- ERBB2 (103)
- PGR (101)
- CTAG1B (96)
- MAP2K3 (96)
- CDKN2A (91)
- ABCB1 (87)
- ADIPOQ (81)
- CD4 (79)
- CD99 (78)
- CHGA (76)
- PCNA (73)
- ERCC1 (72)
- NKX3-1 (72)
- VSNL1 (72)
- CTNNB1 (71)
- PIK3C2A (71)
- TOP2A (69)
- JUN (66)
- AKT1 (65)
- APP (65)
- PTPRC (63)
- SENP2 (63)
- BCL2 (58)
- CD68 (57)
- NCAM1 (57)
- MDM4 (56)
- MS4A1 (55)
- ABAT (54)
- BSG (54)
- PDCD1 (54)
- PIK3CG (54)
- TYMP (54)
- LOX (53)
- VBP1 (53)
- MGLL (52)
- MGMT (52)
- NPR3 (52)
- CTSL (51)
- KIT (51)
- LTA4H (51)
- MCM2 (51)
- PDE4A (51)
- PFKP (51)
- PPP5C (51)
- PROCR (51)
- BUB1B (50)
- UBE2G2 (50)
- AKR1A1 (49)
- CDH1 (49)
- BTK (48)
- F13A1 (48)
- RET (48)
- TYMS (48)
- ESR1 (47)
- GCH1 (47)
- HSPD1 (47)
- NAPSA (47)
- POR (47)
- PTPRE (47)
- ACAT2 (46)
- AMACR (46)
- CD44 (46)
- MDM2 (45)
- MTOR (45)
- NME4 (45)
- NR3C1 (45)
- ALDH1L1 (44)
- SQSTM1 (44)
- STAT4 (44)
- CR2 (43)
- DEF6 (43)
- UNG (43)
- CD63 (42)
- CYP1A2 (42)
- L1CAM (42)
- VWF (42)
- FOS (41)
- RAB21 (41)
- TNFRSF8 (41)
- ATP5F1B (40)
- CFI (40)
- GLI1 (40)
- PRKAR2A (40)
- RHOJ (40)
- SLA2 (40)
- TRIM38 (40)
- AFP (39)
- CD163 (39)
- EGFR (39)
- RPA2 (39)
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Pathways
- Metabolic pathways (2965)
- Pathways in cancer (2933)
- MAPK signaling pathway (1544)
- Prostate cancer (1499)
- Focal adhesion (1498)
- Colorectal cancer (1263)
- Neurotrophin signaling pathway (1244)
- T cell receptor signaling pathway (1192)
- Toll-like receptor signaling pathway (1181)
- Pancreatic cancer (1152)
- ErbB signaling pathway (1139)
- Chronic myeloid leukemia (1120)
- Melanoma (1108)
- Endometrial cancer (1095)
- Glioma (1066)
- Regulation of actin cytoskeleton (1029)
- Non-small cell lung cancer (1028)
- Bladder cancer (1024)
- B cell receptor signaling pathway (984)
- Insulin signaling pathway (976)
- Progesterone-mediated oocyte maturation (970)
- Chemokine signaling pathway (934)
- Cytokine-cytokine receptor interaction (933)
- Cell adhesion molecules (CAMs) (928)
- Apoptosis (925)
- Cell cycle (897)
- Acute myeloid leukemia (894)
- Fc epsilon RI signaling pathway (867)
- Renal cell carcinoma (823)
- Hematopoietic cell lineage (810)
- Small cell lung cancer (771)
- Jak-STAT signaling pathway (759)
- Leukocyte transendothelial migration (747)
- Natural killer cell mediated cytotoxicity (734)
- Fc gamma R-mediated phagocytosis (733)
- GnRH signaling pathway (712)
- Wnt signaling pathway (702)
- p53 signaling pathway (674)
- VEGF signaling pathway (662)
- Thyroid cancer (649)
- Melanogenesis (622)
- Oocyte meiosis (617)
- Gap junction (592)
- Amyotrophic lateral sclerosis (ALS) (586)
- Adherens junction (585)
- Adipocytokine signaling pathway (557)
- Alzheimer's disease (546)
- Neuroactive ligand-receptor interaction (540)
- Calcium signaling pathway (529)
- Endocytosis (529)
- Purine metabolism (527)
- Type II diabetes mellitus (514)
- Vascular smooth muscle contraction (472)
- Pyrimidine metabolism (463)
- mTOR signaling pathway (450)
- Huntington's disease (440)
- Long-term depression (433)
- Long-term potentiation (419)
- Primary immunodeficiency (412)
- Basal cell carcinoma (401)
- Prion diseases (388)
- Complement and coagulation cascades (387)
- Glycolysis / Gluconeogenesis (387)
- Epithelial cell signaling in Helicobacter pylori infection (371)
- Axon guidance (368)
- Tight junction (367)
- Lysosome (356)
- Ubiquitin mediated proteolysis (356)
- Pathogenic Escherichia coli infection (350)
- TGF-beta signaling pathway (331)
- Glycerolipid metabolism (328)
- Phosphatidylinositol signaling system (310)
- Antigen processing and presentation (300)
- Dorso-ventral axis formation (296)
- NOD-like receptor signaling pathway (296)
- Nucleotide excision repair (294)
- ECM-receptor interaction (289)
- RIG-I-like receptor signaling pathway (275)
- Drug metabolism - cytochrome P450 (269)
- Autoimmune thyroid disease (262)
- Dilated cardiomyopathy (259)
- Metabolism of xenobiotics by cytochrome P450 (259)
- Arginine and proline metabolism (250)
- PPAR signaling pathway (247)
- Parkinson's disease (247)
- Arachidonic acid metabolism (246)
- Inositol phosphate metabolism (244)
- Hypertrophic cardiomyopathy (HCM) (240)
- Valine (231)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (227)
- leucine and isoleucine degradation (226)
- DNA replication (219)
- Base excision repair (218)
- Mismatch repair (215)
- Type I diabetes mellitus (214)
- Viral myocarditis (212)
- Retinol metabolism (208)
- Tryptophan metabolism (196)
- Butanoate metabolism (189)
- Cytosolic DNA-sensing pathway (189)
- Fatty acid metabolism (188)
- Hedgehog signaling pathway (187)
- Propanoate metabolism (183)
- Tyrosine metabolism (182)
- Renin-angiotensin system (180)
- Pyruvate metabolism (174)
- ABC transporters (173)
- Homologous recombination (172)
- Alanine (169)
- aspartate and glutamate metabolism (169)
- Allograft rejection (158)
- Proteasome (157)
- Systemic lupus erythematosus (149)
- Lysine degradation (143)
- Notch signaling pathway (137)
- Graft-versus-host disease (131)
- Linoleic acid metabolism (126)
- Pentose phosphate pathway (126)
- Drug metabolism - other enzymes (125)
- beta-Alanine metabolism (121)
- Fructose and mannose metabolism (119)
- Glutathione metabolism (117)
- Starch and sucrose metabolism (114)
- Vibrio cholerae infection (112)
- Galactose metabolism (108)
- Histidine metabolism (107)
- One carbon pool by folate (107)
- Sphingolipid metabolism (97)
- Cardiac muscle contraction (96)
- Oxidative phosphorylation (91)
- Folate biosynthesis (89)
- Citrate cycle (TCA cycle) (82)
- Amino sugar and nucleotide sugar metabolism (81)
- Primary bile acid biosynthesis (77)
- Taste transduction (72)
- Regulation of autophagy (71)
- Spliceosome (71)
- Synthesis and degradation of ketone bodies (71)
- Caffeine metabolism (68)
- Maturity onset diabetes of the young (68)
- Asthma (66)
- RNA degradation (65)
- SNARE interactions in vesicular transport (65)
- Other glycan degradation (64)
- Circadian rhythm - mammal (63)
- Glycerophospholipid metabolism (61)
- Glycine (59)
- serine and threonine metabolism (59)
- Phenylalanine metabolism (58)
- Terpenoid backbone biosynthesis (58)
- Cysteine and methionine metabolism (50)
- Nitrogen metabolism (48)
- Olfactory transduction (45)
- Non-homologous end-joining (44)
- Ribosome (44)
- Glycosaminoglycan degradation (43)
- Methane metabolism (38)
- Androgen and estrogen metabolism (37)
- Glyoxylate and dicarboxylate metabolism (35)
- Porphyrin and chlorophyll metabolism (33)
- Sulfur metabolism (32)
- Ascorbate and aldarate metabolism (28)
- Pantothenate and CoA biosynthesis (28)
- Fatty acid biosynthesis (27)
- Nicotinate and nicotinamide metabolism (27)
- Pentose and glucuronate interconversions (27)
- Limonene and pinene degradation (26)
- Selenoamino acid metabolism (26)
- Ether lipid metabolism (24)
- Taurine and hypotaurine metabolism (23)
- C21-Steroid hormone metabolism (22)
- Biosynthesis of unsaturated fatty acids (20)
- Glycosphingolipid biosynthesis - ganglio series (19)
- Riboflavin metabolism (18)
- Steroid biosynthesis (17)
- Basal transcription factors (15)
- Vitamin B6 metabolism (13)
- leucine and isoleucine biosynthesis (13)
- Aminoacyl-tRNA biosynthesis (12)
- Fatty acid elongation in mitochondria (11)
- Glycosphingolipid biosynthesis - globo series (9)
- Protein export (5)
- D-Glutamine and D-glutamate metabolism (4)
- O-Glycan biosynthesis (4)
- Thiamine metabolism (3)
- alpha-Linolenic acid metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- N-Glycan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- Heparan sulfate biosynthesis (1)
- Phenylalanine (1)
- RNA polymerase (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)