Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal RUNX1 Antibody (S276)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from human RUNX1. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Active filters
Applications
- IHC
Families
- ES Cell Differentiation/IPS
Pathways
- Pathways in cancer
Filter by
Target Symbol
- CTNNB1 (83)
- AKT1 (73)
- JUN (67)
- BCL2 (62)
- EGFR (59)
- KIT (58)
- PIK3CG (54)
- CDH1 (52)
- GLI1 (40)
- STAT5A (35)
- MAPK9 (28)
- MAPK8 (26)
- HGF (23)
- CASP3 (22)
- FGF21 (19)
- FN1 (19)
- BCL2L1 (17)
- DVL2 (17)
- PDGFRA (17)
- PDGFRB (17)
- EGF (16)
- IGF1 (16)
- AKT2 (13)
- SMAD3 (12)
- AKT3 (11)
- GLI2 (11)
- STAT5B (11)
- PRKCA (9)
- ITGA6 (8)
- MAPK3 (8)
- PTCH1 (8)
- LEF1 (7)
- ITGB1 (6)
- SHH (6)
- SMAD2 (6)
- TGFB1 (6)
- WNT3A (6)
- CEBPA (5)
- RUNX1 (5)
- SLC2A1 (5)
- SMO (5)
- WNT1 (5)
- FGF4 (4)
- FGF7 (4)
- FLT3 (4)
- AXIN1 (3)
- AXIN2 (3)
- BMP2 (3)
- CSF3R (3)
- FAS (3)
- GLI3 (3)
- ITGA2B (3)
- LAMA1 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- WNT8A (3)
- FGF18 (2)
- ITGAV (2)
- TCF7 (2)
- WNT8B (2)
- DVL1 (1)
- DVL3 (1)
- FGF10 (1)
- FLT3LG (1)
- WNT7B (1)
Reactivities
- Human (883)
- Mouse (695)
- Rat (656)
- Dog (143)
- Monkey (131)
- Bovine (14)
- Chicken (12)
- Pig (7)
- Primate (6)
- Rabbit (6)
- Bat (5)
- Horse (5)
- Xenopus (4)
- Canine (3)
- Cow (3)
- Gibbon (3)
- Gorilla (3)
- Zebrafish (3)
- Hamster (2)
- X. tropicalis (2)
- Chimpanzee (1)
- Fish (1)
- Gerbil (1)
- Guinea Pig (1)
- Porcine (1)
- Quail (1)
- Rhesus Monkey (1)
- Sheep (1)