Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit Polyclonal Anti-HOXA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal IRF7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Active filters
Reactivities
- Mouse
Applications
- IHC
Families
- Transcription Factors
Filter by
Target Symbol
- MAP2K3 (95)
- CTNNB1 (71)
- JUN (63)
- MEF2C (52)
- MCM2 (51)
- PPP5C (51)
- ESR1 (45)
- STAT4 (44)
- NR3C1 (43)
- SQSTM1 (43)
- TLE1 (43)
- TSC22D1 (41)
- FOS (40)
- GLI1 (39)
- ERG (37)
- ID3 (36)
- RFXANK (35)
- NKX2-1 (34)
- PARN (33)
- SATB1 (33)
- CBX8 (32)
- SKIL (32)
- STAT5A (32)
- CLOCK (31)
- FOXI1 (31)
- NEUROG1 (31)
- NR2C2 (30)
- TP73 (28)
- ATF1 (26)
- HDAC9 (26)
- NONO (26)
- PAX5 (26)
- TRIM28 (26)
- AR (25)
- POGK (25)
- PRRX1 (25)
- RB1 (25)
- SMAD1 (25)
- TCF12 (25)
- APEX1 (24)
- HES1 (24)
- ZEB1 (22)
- GATA3 (21)
- HMG20A (21)
- LHX1 (21)
- EIF4E2 (20)
- ELK3 (20)
- NR4A3 (20)
- PHF20L1 (20)
- PPP1R8 (20)
- CDX2 (19)
- SNAI2 (18)
- ARNT (17)
- MYC (17)
- PSMC3 (17)
- ARNTL (16)
- ASH2L (16)
- BCL6 (16)
- CNOT2 (16)
- GAS7 (16)
- NAB2 (16)
- TP53 (16)
- ERCC8 (15)
- GTF3C4 (15)
- HDAC2 (15)
- HSF2 (15)
- IRF6 (15)
- MAFB (15)
- MEF2D (15)
- NAB1 (15)
- RING1 (15)
- RUVBL2 (15)
- TET3 (15)
- EZH2 (14)
- FOXO4 (14)
- PDX1 (13)
- YBX1 (13)
- ZEB2 (13)
- CDX1 (12)
- ID2 (12)
- KLF5 (12)
- RUNX3 (12)
- SOX17 (12)
- SOX9 (12)
- STAT3 (12)
- THRA (12)
- TRIM33 (12)
- BTG2 (11)
- CNOT4 (11)
- ELF3 (11)
- ESRRG (11)
- FOXP3 (11)
- MXD4 (11)
- NR5A1 (11)
- PBX1 (11)
- RELA (11)
- SEC14L2 (11)
- SIRT5 (11)
- STAT1 (11)
- TRIM27 (11)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (539)
- MAPK signaling pathway (419)
- Toll-like receptor signaling pathway (254)
- Wnt signaling pathway (240)
- Colorectal cancer (230)
- Prostate cancer (196)
- Cell cycle (184)
- Chronic myeloid leukemia (168)
- GnRH signaling pathway (162)
- T cell receptor signaling pathway (155)
- Neurotrophin signaling pathway (152)
- B cell receptor signaling pathway (147)
- Jak-STAT signaling pathway (143)
- TGF-beta signaling pathway (142)
- Focal adhesion (139)
- Basal cell carcinoma (134)
- ErbB signaling pathway (129)
- Endometrial cancer (122)
- Acute myeloid leukemia (120)
- Thyroid cancer (119)
- Amyotrophic lateral sclerosis (ALS) (117)
- Adherens junction (113)
- Pancreatic cancer (112)
- Renal cell carcinoma (107)
- Small cell lung cancer (105)
- Fc epsilon RI signaling pathway (99)
- Melanogenesis (91)
- Epithelial cell signaling in Helicobacter pylori infection (89)
- Tight junction (89)
- Pathogenic Escherichia coli infection (78)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (77)
- Huntington's disease (75)
- Chemokine signaling pathway (74)
- Maturity onset diabetes of the young (74)
- Leukocyte transendothelial migration (72)
- RNA degradation (67)
- Adipocytokine signaling pathway (65)
- Bladder cancer (64)
- DNA replication (61)
- Apoptosis (59)
- Neuroactive ligand-receptor interaction (58)
- Antigen processing and presentation (57)
- Ubiquitin mediated proteolysis (56)
- Non-small cell lung cancer (55)
- Circadian rhythm - mammal (54)
- p53 signaling pathway (54)
- Notch signaling pathway (51)
- Cytosolic DNA-sensing pathway (47)
- Melanoma (47)
- Glioma (45)
- Primary immunodeficiency (44)
- Oocyte meiosis (42)
- Hedgehog signaling pathway (41)
- Insulin signaling pathway (41)
- Base excision repair (38)
- RIG-I-like receptor signaling pathway (38)
- Metabolic pathways (37)
- NOD-like receptor signaling pathway (32)
- Nucleotide excision repair (26)
- mTOR signaling pathway (26)
- PPAR signaling pathway (25)
- Purine metabolism (20)
- Pyrimidine metabolism (20)
- Type II diabetes mellitus (19)
- RNA polymerase (18)
- Basal transcription factors (17)
- Proteasome (17)
- Endocytosis (16)
- Dorso-ventral axis formation (15)
- Viral myocarditis (15)
- Axon guidance (14)
- Natural killer cell mediated cytotoxicity (14)
- Allograft rejection (11)
- Graft-versus-host disease (11)
- Type I diabetes mellitus (11)
- VEGF signaling pathway (10)
- Alzheimer's disease (8)
- Autoimmune thyroid disease (8)
- Cell adhesion molecules (CAMs) (8)
- Cytokine-cytokine receptor interaction (8)
- Long-term depression (8)
- Cysteine and methionine metabolism (7)
- Systemic lupus erythematosus (7)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Ribosome (6)
- Vascular smooth muscle contraction (5)
- Glycolysis / Gluconeogenesis (4)
- Long-term potentiation (4)
- Non-homologous end-joining (4)
- Asthma (3)
- Calcium signaling pathway (3)
- Fc gamma R-mediated phagocytosis (3)
- Hematopoietic cell lineage (3)
- Homologous recombination (3)
- Prion diseases (3)
- Progesterone-mediated oocyte maturation (2)
- Regulation of actin cytoskeleton (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Biosynthesis of unsaturated fatty acids (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Spliceosome (1)
- serine and threonine metabolism (1)