Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Rabbit Polyclonal Anti-PROM1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PROM1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PROM1. |
Phospho-PRKCB-T641 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB |
Modifications | Phospho-specific |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
PLCG2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCG2 |
Rabbit Polyclonal Anti-INPP5K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SYNJ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR |
Rabbit Polyclonal Anti-PRRX1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PRRX1 antibody was raised against a 19 amino acid peptide near the center of human PRRX1. |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PIP5K1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ |
Rabbit anti-PRKCB Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-SYNJ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP |
Rabbit Polyclonal Anti-INPP5J Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-INPP5J antibody is: synthetic peptide directed towards the N-terminal region of Human INPP5J. Synthetic peptide located within the following region: RSPSHSPNRSPCVPPAPDMALPRLGTQSTGPGRCLSPNLQAQEAPAPVTT |
Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS |
Rabbit Polyclonal Anti-SYNJ2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
Rabbit Polyclonal Anti-DGKD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Antibody against VPS34
Applications | WB |
Reactivities | Human, Rat, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 700-850). [Swiss-Prot# Q8NEB9] |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal PLCG1 (Ab-771) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Rabbit polyclonal anti-ITPKB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ITPKB. |
Rabbit polyclonal anti-PIK3C2G antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human P3C2G. |
Rabbit polyclonal anti-PLCB2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PLCB2. |
Rabbit polyclonal anti-DGKI antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DGKI. |
Rabbit polyclonal anti-IPPK antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IPPK. |
Rabbit polyclonal anti-DGKH antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKH. |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
Anti-PLCG2 (Phospho-Tyr753) Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 753 (S-L-Y(p)-D-V) derived from Human PLC?2. |
Modifications | Phospho-specific |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
Modifications | Phospho-specific |
Rabbit polyclonal PI3KC3 Antibody (S34)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3. |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit polyclonal PIK3CG antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIK3CG. |
Rabbit Polyclonal Anti-IMPA1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IMPA1 antibody: synthetic peptide directed towards the middle region of human IMPA1. Synthetic peptide located within the following region: IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE |
Rabbit Polyclonal Anti-IMPA2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Impa2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Impa2. Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA |
Rabbit Polyclonal Anti-IMPA2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IMPA2 antibody: synthetic peptide directed towards the middle region of human IMPA2. Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH |
Rabbit Polyclonal Anti-IPPK Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IPPK antibody: synthetic peptide directed towards the middle region of human IPPK. Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH |
Rabbit Polyclonal Anti-SHIP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHIP1 Antibody: A synthesized peptide derived from human SHIP1 |
Rabbit Polyclonal Anti-ITPK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1 |
Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha |
Rabbit Polyclonal Anti-INPP4B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | INPP4B antibody was raised against a 17 amino acid peptide near the amino terminus of human INPP4B. |
Rabbit polyclonal antibody to INPP1 (inositol polyphosphate-1-phosphatase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 269 of INPP1 (Uniprot ID#P49441) |
Rabbit Polyclonal antibody to PI3 kinase p110 beta (phosphoinositide-3-kinase, catalytic, beta polypeptide)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 509 and 820 of PI3 kinase p110 beta (Uniprot ID#P42338) |
Rabbit polyclonal anti-DGKA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Rabbit polyclonal PKC a (Ab-657) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-PIK3R5 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIK3R5. |
Rabbit polyclonal anti-DGKB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKB. |